KEGG   Homo sapiens (human): 30
Entry
30                CDS       T01001                                 
Symbol
ACAA1, ACAA, Lnc-Myd88, PTHIO, THIO
Name
(RefSeq) acetyl-CoA acyltransferase 1
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00592  alpha-Linolenic acid metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00087  beta-Oxidation
hsa_M00861  beta-Oxidation, peroxisome, VLCFA
Network
nt06021  beta-Oxidation in peroxisome
nt06024  Valine, leucine and isoleucine degradation
  Element
N00776  beta-Oxidation, peroxisome, VLCFA
N00856  Isoleucine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    30 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    30 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    30 (ACAA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    30 (ACAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    30 (ACAA1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    30 (ACAA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     30 (ACAA1)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Other DBs
NCBI-GeneID: 30
NCBI-ProteinID: NP_001598
OMIM: 604054
HGNC: 82
Ensembl: ENSG00000060971
Pharos: P09110(Tbio)
UniProt: P09110 A0A024R2M6
Structure
LinkDB
Position
3:complement(38122715..38137127)
AA seq 424 aa
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIP
MGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSI
TVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLR
LPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
YPGN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcagaggctgcaggtagtgctgggccacctgaggggtccggccgattccggctggatg
ccgcaggccgcgccttgcctgagcggtgccccgcaggcctcggccgcggacgtggtggtg
gtgcacgggcggcgcacggccatctgccgggcgggccgcggcggcttcaaggacaccacc
cccgacgagcttctctcggcagtcatgaccgcggttctcaaggacgtgaatctgaggccg
gaacagctgggggacatctgtgtcggaaatgtgctgcagcctggggccggggcaatcatg
gcccgaatcgcccagtttctgagtgacatcccggagactgtgcctttgtccactgtcaat
agacagtgttcgtcggggctacaggcagtggccagcatagcaggtggcatcagaaatggg
tcttatgacattggcatggcctgtggggtggagtccatgtccctggctgacagagggaac
cctggaaatattacttcgcgcttgatggagaaggagaaggccagagattgcctgattcct
atggggataacctctgagaatgtggctgagcggtttggcatttcacgggagaagcaggat
acctttgccctggcttcccagcagaaggcagcaagagcccagagcaagggctgtttccaa
gctgagattgtgcctgtgaccaccacggtccatgatgacaagggcaccaagaggagcatc
actgtgacccaggatgagggtatccgccccagcaccaccatggagggcctggccaaactg
aagcctgccttcaagaaagatggttctaccacagctggaaactctagccaggtgagtgat
ggggcagctgccatcctgctggcccggaggtccaaggcagaagagttgggccttcccatc
cttggggtcctgaggtcttatgcagtggttggggtcccacctgacatcatgggcattgga
cctgcctatgccatcccagtagctttgcaaaaagcagggctgacagtgagtgacgtggac
atcttcgagatcaatgaggcctttgcaagccaggctgcctactgtgtggagaagctacga
ctcccccctgagaaggtgaaccccctggggggtgcagtggccttagggcacccactgggc
tgcactggggcacgacaggtcatcacgctgctcaatgagctgaagcgccgtgggaagagg
gcatacggagtggtgtccatgtgcatcgggactggaatgggagccgctgccgtctttgaa
taccctgggaactga

KEGG   Homo sapiens (human): 6342
Entry
6342              CDS       T01001                                 
Symbol
SCP2, NLTP, NSL-TP, SCOX, SCP-2, SCP-CHI, SCP-X, SCPX
Name
(RefSeq) sterol carrier protein 2
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
hsa_M00861  beta-Oxidation, peroxisome, VLCFA
hsa_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Network
nt06021  beta-Oxidation in peroxisome
nt06022  Bile acid biosynthesis
  Element
N00776  beta-Oxidation, peroxisome, VLCFA
N00779  beta-Oxidation, peroxisome, bile acid
N00805  Bile acid biosynthesis
Disease
H00407  Peroxisomal beta-oxidation enzyme deficiency
H00874  Leukoencephalopathy with dystonia and motor neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    6342 (SCP2)
   01040 Biosynthesis of unsaturated fatty acids
    6342 (SCP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    6342 (SCP2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    6342 (SCP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     6342 (SCP2)
SSDB
Motif
Pfam: SCP2 Thiolase_N Thiolase_C ACP_syn_III Alkyl_sulf_C Ketoacyl-synt_C ketoacyl-synt SpoVAD
Other DBs
NCBI-GeneID: 6342
NCBI-ProteinID: NP_002970
OMIM: 184755
HGNC: 10606
Ensembl: ENSG00000116171
Pharos: P22307(Tchem)
UniProt: P22307 A0A384NY87 Q59HG9 B2R761
Structure
LinkDB
Position
1:52927276..53051698
AA seq 547 aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQA
CVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALG
FEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEH
FAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEA
FVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDID
VIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
QPGNAKL
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtcctcttccccgtgggagcctgcgaccctgcgccgggtgttcgtggtgggggttggc
atgaccaagtttgtgaagcctggagctgagaattcaagagactaccctgacttggcagaa
gaagcaggcaagaaggctttagctgatgcacagatcccttattcagcagtggaccaggca
tgtgttggctatgtttttggtgactctacctgtgggcagagggctatctatcacagtttg
ggaatgactggaattcctataatcaatgtcaacaataactgtgctactggttctactgct
ttgtttatggcccgccagctgattcagggtggtgtggcagaatgtgtcttggctcttggg
tttgagaagatgagtaagggaagccttggaataaaattttcagatagaaccattcccact
gataagcatgttgacctcctgatcaataagtatggattgtctgctcacccagttgctcct
cagatgtttgggtatgctggaaaagaacatatggaaaaatatggaacaaaaattgaacac
tttgcaaaaattggatggaaaaatcataaacattcagttaataacccgtattcccagttc
caagatgaatacagtttagatgaagtgatggcatctaaagaagtttttgattttttgact
atcttacaatgttgtcccacttcagatggtgctgcagcagcaattttggccagtgaagca
tttgtacagaagtatggcctgcaatccaaagctgtggaaattttggcacaagaaatgatg
actgatttgccaagctcgtttgaagaaaaaagcattattaaaatggttggctttgatatg
agtaaagaagctgcaagaaaatgctatgagaaatctggcctgacaccaaatgatattgac
gtaatagaacttcacgattgcttttctaccaacgaactccttacttatgaagcactggga
ctctgtccagaaggacaaggtgcaacgctggttgatagaggagataatacatatggagga
aagtgggtcataaatcctagtggtggactgatttcaaagggacacccactaggcgctaca
ggtcttgctcagtgtgcagaactctgctggcagctgagaggggaagccggaaagaggcaa
gttcctggtgcaaaggtggctctgcagcataatttaggcattggaggagctgtggttgta
acactctacaagatgggttttccggaagccgccagttcttttagaactcatcaaattgaa
gctgttccaaccagctctgcaagtgatggatttaaggcaaatcttgtttttaaggagatt
gagaagaaacttgaagaggaaggggaacagtttgtgaagaaaatcggtggtatttttgcc
ttcaaggtgaaagatggccctgggggtaaagaggccacctgggtggtggatgtgaagaat
ggcaaaggatcagtgcttcctaactcagataagaaggctgactgcacaatcacaatggct
gactcagacttcctggctttaatgactggtaaaatgaatcctcagtcggccttctttcaa
ggcaaattgaaaatcactggcaacatgggtctcgctatgaagttacaaaatcttcagctt
cagccaggcaacgctaagctctga

DBGET integrated database retrieval system