| Entry |
|
| Symbol |
COX8C, COX8-3
|
| Name |
(RefSeq) cytochrome c oxidase subunit 8C
|
| KO |
| K02273 | cytochrome c oxidase subunit 8 |
|
| Organism |
|
| Pathway |
| hsa04932 | Non-alcoholic fatty liver disease |
| hsa05022 | Pathways of neurodegeneration - multiple diseases |
| hsa05208 | Chemical carcinogenesis - reactive oxygen species |
|
| Module |
|
| Network |
nt06252 Mitochondrial ROS formation (cancer) nt06460 Alzheimer disease nt06466 Pathways of neurodegeneration |
| Element |
| N00998 | Electron transfer in Complex IV |
| N00999 | Mutation-caused aberrant Abeta to electron transfer in Complex IV |
| N01394 | Arsenic to electron transfer in complex IV |
|
| Brite |
KEGG Orthology (KO) [BR:hsa00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
341947 (COX8C)
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
341947 (COX8C)
09159 Environmental adaptation
04714 Thermogenesis
341947 (COX8C)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
341947 (COX8C)
09164 Neurodegenerative disease
05010 Alzheimer disease
341947 (COX8C)
05012 Parkinson disease
341947 (COX8C)
05014 Amyotrophic lateral sclerosis
341947 (COX8C)
05016 Huntington disease
341947 (COX8C)
05020 Prion disease
341947 (COX8C)
05022 Pathways of neurodegeneration - multiple diseases
341947 (COX8C)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
341947 (COX8C)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
341947 (COX8C)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| Position |
14:93347182..93348356
|
| AA seq |
72 aa
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA
YVLGNLKQFRRN |
| NT seq |
219 nt +upstreamnt +downstreamnt
atgcctctcctgcgtgggcgctgtcctgcccgccgccactaccgccgcttggccctgctc
ggcctgcagcccgctccccgcttcgcccactcggggcccccgcgccagcggcccctgtct
gccgcggaaatggctgttggacttgtggtgttttttacgaccttcttaacaccagctgca
tatgtgctaggcaacctgaagcagttcagaaggaattag |