KEGG   Homo sapiens (human): 3663
Entry
3663              CDS       T01001                                 
Symbol
IRF5, SLEB10
Name
(RefSeq) interferon regulatory factor 5
  KO
K09446  interferon regulatory factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
Disease
H00080  Systemic lupus erythematosus
H00630  Rheumatoid arthritis
H01227  Inflammatory bowel disease (IBD)
H01492  Systemic sclerosis
H01502  Sjogren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3663 (IRF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3663 (IRF5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3663 (IRF5)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 3663
NCBI-ProteinID: NP_001092097
OMIM: 607218
HGNC: 6120
Ensembl: ENSG00000128604
Pharos: Q13568(Tbio)
UniProt: Q13568
Structure
LinkDB
Position
7:128937032..128950038
AA seq 498 aa
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEV
CSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQ
PPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI
SPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP
IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPG
AGLGVGQGPWPMHPAGMQ
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaaccagtccatcccagtggctcccaccccaccccgccgcgtgcggctgaagccctgg
ctggtggcccaggtgaacagctgccagtacccagggcttcaatgggtcaacggggaaaag
aaattattctgcatcccctggaggcatgccacaaggcatggtcccagccaggacggagat
aacaccatcttcaaggcctgggccaaggagacagggaaatacaccgaaggcgtggatgaa
gccgatccggccaagtggaaggccaacctgcgctgtgcccttaacaagagccgggacttc
cgcctcatctacgacgggccccgggacatgccacctcagccctacaagatctacgaggtc
tgctccaatggccctgctcccacagactcccagccccctgaggattactcttttggtgca
ggagaggaggaggaagaagaggaagagctgcagaggatgttgccaagcctgagcctcaca
gaggatgtcaagtggccgcccactctgcagccgcccactctgcggccgcctactctgcag
ccgcccactctgcagccgcccgtggtgctgggtccccctgctccagaccccagccccctg
gctcctccccctggcaaccctgctggcttcagggagcttctctctgaggtcctggagcct
gggcccctgcctgccagcctgccccctgcaggcgaacagctcctgccagacctgctgatc
agcccccacatgctgcctctgaccgacctggagatcaagtttcagtaccgggggcggcca
ccccgggccctcaccatcagcaacccccatggctgccggctcttctacagccagctggag
gccacccaggagcaggtggaactcttcggccccataagcctggagcaagtgcgcttcccc
agccctgaggacatccccagtgacaagcagcgcttctacacgaaccagctgctggatgtc
ctggaccgcgggctcatcctccagctacagggccaggacctttatgccatccgcctgtgt
cagtgcaaggtgttctggagcgggccttgtgcctcagcccatgactcatgccccaacccc
atccagcgggaggtcaagaccaagcttttcagcctggagcattttctcaatgagctcatc
ctgttccaaaagggccagaccaacaccccaccacccttcgagatcttcttctgctttggg
gaagaatggcctgaccgcaaaccccgagagaagaagctcattactgtacaggtggtgcct
gtagcagctcgactgctgctggagatgttctcaggggagctatcttggtcagctgatagt
atccggctacagatctcaaacccagacctcaaagaccgcatggtggagcaattcaaggag
ctccatcacatctggcagtcccagcagcggttgcagcctgtggcccaggcccctcctgga
gcaggccttggtgttggccaggggccctggcctatgcacccagctggcatgcaataa

DBGET integrated database retrieval system