KEGG   Homo sapiens (human): 3798
Entry
3798              CDS       T01001                                 

Gene name
KIF5A, ALS25, D12S1889, MY050, NEIMY, NKHC, SPG10
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04728  Dopaminergic synapse
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
hsa05223  Non-small cell lung cancer
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06465  Prion disease
  Element
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01017  Mutation-caused aberrant PSEN1 to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01202  Oligomeric conformation PrPc to anterograde axonal transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3798 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    3798 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    3798 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3798 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3798 (KIF5A)
   05012 Parkinson disease
    3798 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    3798 (KIF5A)
   05016 Huntington disease
    3798 (KIF5A)
   05020 Prion disease
    3798 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    3798 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3798 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3798 (KIF5A)
   04147 Exosome [BR:hsa04147]
    3798 (KIF5A)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    3798 (KIF5A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3798 (KIF5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3798 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF3584 ATG16 Spc7
Other DBs
NCBI-GeneID: 3798
NCBI-ProteinID: NP_004975
OMIM: 602821
HGNC: 6323
Ensembl: ENSG00000155980
Vega: OTTHUMG00000170143
Pharos: Q12840(Tbio)
UniProt: Q12840
LinkDB
Structure
PDB: 
4UXY 4UXT 4UY0

Position
12q13.3
AA seq 1032 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgattccggcccctgaac
caggctgagattctgcggggagacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccatatgtttttgaccgtgtattccccccaaacacgactcaagag
caagtttatcatgcatgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatttttgcttatggacagacatcctcagggaaaacacataccatggagggaaagctg
cacgaccctcagctgatgggaatcattcctcgaattgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacatcaaggtttcttactttgaaatttacctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatctgtccgtgcacgaggacaag
aaccgggtgccatttgtcaagggttgtactgaacgctttgtgtccagcccggaggagatt
ctggatgtgattgatgaagggaaatcaaatcgtcatgtggctgtcaccaacatgaatgaa
cacagctctcggagccacagcatcttcctcatcaacatcaagcaggagaacatggaaacg
gagcagaagctcagtgggaagctgtatctggtggacctggcagggagtgagaaggtcagc
aagactggagcagagggagccgtgctggacgaggcaaagaatatcaacaagtcactgtca
gctctgggcaatgtgatctccgcactggctgagggcactaaaagctatgttccatatcgt
gacagcaaaatgacaaggattctccaggactctctcgggggaaactgccggacgactatg
ttcatctgttgctcaccatccagttataatgatgcagagaccaagtccaccctgatgttt
gggcagcgggcaaagaccattaagaacactgcctcagtaaatttggagttgactgctgag
cagtggaagaagaaatatgagaaggagaaggagaagacaaaggcccagaaggagacgatt
gcgaagctggaggctgagctgagccggtggcgcaatggagagaatgtgcctgagacagag
cgcctggctggggaggaggcagccctgggagccgagctctgtgaggagacccctgtgaat
gacaactcatccatcgtggtgcgcatcgcgcccgaggagcggcagaaatacgaggaggag
atccgccgtctctataagcagcttgacgacaaggatgatgaaatcaaccaacaaagccaa
ctcatagagaagctcaagcagcaaatgctggaccaggaagagctgctggtgtccacccga
ggagacaacgagaaggtccagcgggagctgagccacctgcaatcagagaacgatgccgct
aaggatgaggtgaaggaagtgctgcaggccctggaggagctggctgtgaactatgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgagttgcagcggctacaggaggtcagt
ggacaccagcgaaaacgaattgctgaggtgctgaacgggctgatgaaggatctgagcgag
ttcagtgtcattgtgggcaacggggagattaagctgccagtggagatcagtggggccatc
gaggaggagttcactgtggcccgactctacatcagcaaaatcaaatcagaagtcaagtct
gtggtcaagcggtgccggcagctggagaacctccaggtggagtgtcaccgcaagatggaa
gtgaccgggcgggagctctcatcctgccagctcctcatctctcagcatgaggccaagatc
cgctcgcttacggaatacatgcagagcgtggagctaaagaagcggcacctggaagagtcc
tatgactccttgagcgatgagctggccaagctccaggcccaggaaactgtgcatgaagtg
gccctgaaggacaaggagcctgacactcaggatgcagatgaagtgaagaaggctctggag
ctgcagatggagagtcaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaacgagaagcagaagaccattgatgagctcaaagacctaaatcagaagctccagtta
gagctagagaagcttcaggctgactacgagaagctgaagagcgaagaacacgagaagagc
accaagctgcaggagctgacatttctgtacgagcgacatgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaagacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggccgttcgctacaagagctcgggcaaacggggccattctgcccagattgccaaa
cccgtccggcctggccactacccagcatcctcacccaccaacccctatggcacccggagc
cctgagtgcatcagttacaccaacagcctcttccagaactaccagaatctctacctgcag
gccacacccagctccacctcagatatgtactttgcaaactcctgtaccagcagtggagcc
acatcttctggcggccccttggcttcctaccagaaggccaacatggacaatggaaatgcc
acagatatcaatgacaataggagtgacctgccgtgtggctatgaggctgaggaccaggcc
aagcttttccctctccaccaagagacagcagccagctaa

DBGET integrated database retrieval system