KEGG   Homo sapiens (human): 4153
Entry
4153              CDS       T01001                                 
Symbol
MBL2, COLEC1, HSMBPC, MBL, MBL2D, MBP, MBP-C, MBP1, MBPD
Name
(RefSeq) mannose binding lectin 2
  KO
K03991  mannose-binding lectin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
  Element
N01312  SARS-CoV-2 S to lectin pathway of complement cascade
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation cascade
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01502  Lectin pathway of coagulation cascade, fibrinogen to fibrin
Disease
H00105  Mannose-binding lectin pathway component defects
H00342  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4153 (MBL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    4153 (MBL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    4153 (MBL2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    4153 (MBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4153 (MBL2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    4153 (MBL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    4153 (MBL2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   4153 (MBL2)
SSDB
Motif
Pfam: Lectin_C Collagen Thioredoxin_14
Other DBs
NCBI-GeneID: 4153
NCBI-ProteinID: NP_000233
OMIM: 154545
HGNC: 6922
Ensembl: ENSG00000165471
Pharos: P11226(Tbio)
UniProt: P11226
Structure
LinkDB
Position
10:complement(52765380..52772784)
AA seq 248 aa
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtccctgtttccatcactccctctccttctcctgagtatggtggcagcgtcttactca
gaaactgtgacctgtgaggatgcccaaaagacctgccctgcagtgattgcctgtagctct
ccaggcatcaacggcttcccaggcaaagatgggcgtgatggcaccaagggagaaaagggg
gaaccaggccaagggctcagaggcttacagggcccccctggaaagttggggcctccagga
aatccagggccttctgggtcaccaggaccaaagggccaaaaaggagaccctggaaaaagt
ccggatggtgatagtagcctggctgcctcagaaagaaaagctctgcaaacagaaatggca
cgtatcaaaaagtggctcaccttctctctgggcaaacaagttgggaacaagttcttcctg
accaatggtgaaataatgacctttgaaaaagtgaaggccttgtgtgtcaagttccaggcc
tctgtggccacccccaggaatgctgcagagaatggagccattcagaatctcatcaaggag
gaagccttcctgggcatcactgatgagaagacagaagggcagtttgtggatctgacagga
aatagactgacctacacaaactggaacgagggtgaacccaacaatgctggttctgatgaa
gattgtgtattgctactgaaaaatggccagtggaatgacgtcccctgctccacctcccat
ctggccgtctgtgagttccctatctga

KEGG   Homo sapiens (human): 10584
Entry
10584             CDS       T01001                                 
Symbol
COLEC10, 3MC3, CL-10, CL-34, CLL1
Name
(RefSeq) collectin subfamily member 10
  KO
K10065  collectin sub-family member 10
Organism
hsa  Homo sapiens (human)
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
  Element
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation cascade
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01502  Lectin pathway of coagulation cascade, fibrinogen to fibrin
Disease
H01887  3MC syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    10584 (COLEC10)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   10584 (COLEC10)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 10584
NCBI-ProteinID: NP_006429
OMIM: 607620
HGNC: 2220
Ensembl: ENSG00000184374
Pharos: Q9Y6Z7(Tbio)
UniProt: Q9Y6Z7 A0A024R9J3
LinkDB
Position
8:118952263..119108455
AA seq 277 aa
MNGFASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCATHTISPGPKGDDGEKGDPGE
EGKHGKVGRMGPKGIKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCD
CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG
GMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPS
DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaatggctttgcatccttgcttcgaagaaaccaatttatcctcctggtactatttctt
ttgcaaattcagagtctgggtctggatattgatagccgtcctaccgctgaagtctgtgcc
acacacacaatttcaccaggacccaaaggagatgatggtgaaaaaggagatccaggagaa
gagggaaagcatggcaaagtgggacgcatggggccgaaaggaattaaaggagaactgggt
gatatgggagatcagggcaatattggcaagactgggcccattgggaagaagggtgacaaa
ggggaaaaaggtttgcttggaatacctggagaaaaaggcaaagcaggtactgtctgtgat
tgtggaagataccggaaatttgttggacaactggatattagtattgctcggctcaagaca
tctatgaagtttgtcaagaatgtgatagcagggattagggaaactgaagagaaattctac
tacatcgtgcaggaagagaagaactacagggaatccctaacccactgcaggattcggggt
ggaatgctagccatgcccaaggatgaagctgccaacacactcatcgctgactatgttgcc
aagagtggcttctttcgggtgttcattggcgtgaatgaccttgaaagggagggacagtac
atgttcacagacaacactccactgcagaactatagcaactggaatgagggggaacccagc
gacccctatggtcatgaggactgtgtggagatgctgagctctggcagatggaatgacaca
gagtgccatcttaccatgtactttgtctgtgagttcatcaagaagaaaaagtaa

KEGG   Homo sapiens (human): 78989
Entry
78989             CDS       T01001                                 
Symbol
COLEC11, 3MC2, CL-11, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK1
Name
(RefSeq) collectin subfamily member 11
  KO
K10066  collectin sub-family member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
  Element
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation cascade
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01502  Lectin pathway of coagulation cascade, fibrinogen to fibrin
Disease
H01887  3MC syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    78989 (COLEC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    78989 (COLEC11)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    78989 (COLEC11)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    78989 (COLEC11)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   78989 (COLEC11)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 78989
NCBI-ProteinID: NP_076932
OMIM: 612502
HGNC: 17213
Ensembl: ENSG00000118004
Pharos: Q9BWP8(Tbio)
UniProt: Q9BWP8
Structure
LinkDB
Position
2:3595112..3644644
AA seq 271 aa
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGR
VGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRK
AIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMP
KDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEE
DCVEMVASGGWNDVACHTTMYFMCEFDKENM
NT seq 816 nt   +upstreamnt  +downstreamnt
atgagggggaatctggccctggtgggcgttctaatcagcctggccttcctgtcactgctg
ccatctggacatcctcagccggctggcgatgacgcctgctctgtgcagatcctcgtccct
ggcctcaaaggggatgcgggagagaagggagacaaaggcgcccccggacggcctggaaga
gtcggccccacgggagaaaaaggagacatgggggacaaaggacagaaaggcagtgtgggt
cgtcatggaaaaattggtcccattggctctaaaggtgagaaaggagattccggtgacata
ggaccccctggtcctaatggagaaccaggcctcccatgtgagtgcagccagctgcgcaag
gccatcggggagatggacaaccaggtctctcagctgaccagcgagctcaagttcatcaag
aatgctgtcgccggtgtgcgcgagacggagagcaagatctacctgctggtgaaggaggag
aagcgctacgcggacgcccagctgtcctgccagggccgcgggggcacgctgagcatgccc
aaggacgaggctgccaatggcctgatggccgcatacctggcgcaagccggcctggcccgt
gtcttcatcggcatcaacgacctggagaaggagggcgccttcgtgtactctgaccactcc
cccatgcggaccttcaacaagtggcgcagcggtgagcccaacaatgcctacgacgaggag
gactgcgtggagatggtggcctcgggcggctggaacgacgtggcctgccacaccaccatg
tacttcatgtgtgagtttgacaaggagaacatgtga

KEGG   Homo sapiens (human): 2219
Entry
2219              CDS       T01001                                 
Symbol
FCN1, FCNM
Name
(RefSeq) ficolin 1
  KO
K10104  ficolin
Organism
hsa  Homo sapiens (human)
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
  Element
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation cascade
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01502  Lectin pathway of coagulation cascade, fibrinogen to fibrin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    2219 (FCN1)
Lectins [BR:hsa04091]
 Ficolins
  2219 (FCN1)
SSDB
Motif
Pfam: Fibrinogen_C Collagen
Other DBs
NCBI-GeneID: 2219
NCBI-ProteinID: NP_001994
OMIM: 601252
HGNC: 3623
Ensembl: ENSG00000085265
Pharos: O00602(Tbio)
UniProt: O00602
Structure
LinkDB
Position
9:complement(134903232..134917912)
AA seq 326 aa
MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAP
GPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
LLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFG
SQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFV
GGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
ANGINWSAAKGYKYSYKVSEMKVRPA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagctgagtggagccaccatggcccgggggctcgctgtcctgctagtcttgttcctg
catatcaagaacctgcctgcccaggctgcggacacatgtccagaggtgaaggtggtgggc
ctggagggctctgacaagctcaccattctccgaggctgcccggggctgcccggggcccca
gggccaaagggagaggcaggtgtcattggagagagaggagaacgcggtctccctggagcc
cctggaaaggcaggaccagtggggcccaaaggagaccgaggagagaaggggatgcgtgga
gagaaaggagacgctgggcagtctcagtcgtgtgcgacaggcccacgcaactgcaaggac
ctgctagaccgggggtatttcctgagcggctggcacaccatctacctgcccgactgccgg
cccctgactgtgctctgtgacatggacacggacggagggggctggaccgttttccagcgg
aggatggatggctctgtggacttctatcgggactgggccgcatacaagcagggcttcggc
agtcagctgggggagttctggctggggaatgacaacatccacgccctgactgcccaggga
agcagcgagctccgtgtagacctggtggactttgagggcaaccaccagtttgctaagtac
aaatcattcaaggtggctgacgaggcagagaagtacaagctggtactgggagcctttgtc
gggggcagtgcgggtaattctctaacgggccacaacaacaacttcttctccaccaaagac
caagacaatgatgtgagttcttcgaattgtgctgagaagttccaaggagcctggtggtac
gccgactgtcatgcttcaaacctcaatggtctctacctcatgggaccccatgagagctat
gccaatggtatcaactggagtgcggcgaaggggtacaaatatagctacaaggtgtcagag
atgaaggtgcggcccgcctag

KEGG   Homo sapiens (human): 2220
Entry
2220              CDS       T01001                                 
Symbol
FCN2, EBP-37, FCNL, P35, ficolin-2
Name
(RefSeq) ficolin 2
  KO
K10104  ficolin
Organism
hsa  Homo sapiens (human)
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
  Element
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation cascade
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01502  Lectin pathway of coagulation cascade, fibrinogen to fibrin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    2220 (FCN2)
Lectins [BR:hsa04091]
 Ficolins
  2220 (FCN2)
SSDB
Motif
Pfam: Fibrinogen_C Collagen
Other DBs
NCBI-GeneID: 2220
NCBI-ProteinID: NP_004099
OMIM: 601624
HGNC: 3624
Ensembl: ENSG00000160339
Pharos: Q15485(Tbio)
UniProt: Q15485
Structure
LinkDB
Position
9:134864144..134887523
AA seq 313 aa
MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPG
PKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
IYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNI
HALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNN
QSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYN
YSYKVSEMKVRPA
NT seq 942 nt   +upstreamnt  +downstreamnt
atggagctggacagagctgtgggggtcctgggcgctgccaccctgctgctctctttcctg
ggcatggcctgggctctccaggcggcagacacctgtccagaggtgaagatggtgggcctg
gagggctctgacaagctcaccattctccgaggctgtccggggctgcctggggcccctggg
cccaagggagaggcaggcaccaatggaaagagaggagaacgtggcccccctggacctcct
gggaaggcaggaccacctgggcccaacggagcacctggggagccccagccgtgcctgaca
ggcccgcgtacctgcaaggacctgctagaccgagggcacttcctgagcggctggcacacc
atctacctgcccgactgccggcccctgactgtgctctgtgacatggacacggacggaggg
ggctggaccgttttccagcggagggtggatggctctgtggacttctaccgggactgggcc
acgtacaagcagggcttcggcagtcggctgggggagttctggctggggaatgacaacatc
cacgccctgaccgcccagggaaccagcgagctccgtgtagacctggtggactttgaggac
aactaccagtttgctaagtacagatcattcaaggtggccgacgaggcggagaagtacaat
ctggtcctgggggccttcgtggagggcagtgcgggagattccctgacgttccacaacaac
cagtccttctccaccaaagaccaggacaatgatcttaacaccggaaattgtgctgtgatg
tttcagggagcttggtggtacaaaaactgccatgtgtcaaacctgaatggtcgctacctc
agggggactcatggcagctttgcaaatggcatcaactggaagtcggggaaaggatacaat
tatagctacaaggtgtcagagatgaaggtgcgacctgcctag

KEGG   Homo sapiens (human): 8547
Entry
8547              CDS       T01001                                 
Symbol
FCN3, FCNH, HAKA1
Name
(RefSeq) ficolin 3
  KO
K10104  ficolin
Organism
hsa  Homo sapiens (human)
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
  Element
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation cascade
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01502  Lectin pathway of coagulation cascade, fibrinogen to fibrin
Disease
H00105  Mannose-binding lectin pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    8547 (FCN3)
Lectins [BR:hsa04091]
 Ficolins
  8547 (FCN3)
SSDB
Motif
Pfam: Fibrinogen_C Collagen
Other DBs
NCBI-GeneID: 8547
NCBI-ProteinID: NP_003656
OMIM: 604973
HGNC: 3625
Ensembl: ENSG00000142748
Pharos: O75636(Tbio)
UniProt: O75636 Q6UY50
Structure
LinkDB
Position
1:complement(27369110..27374824)
AA seq 299 aa
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPG
PQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF
CDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELR
VELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDS
SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
NT seq 900 nt   +upstreamnt  +downstreamnt
atggatctactgtggatcctgccctccctgtggcttctcctgcttggggggcctgcctgc
ctgaagacccaggaacaccccagctgcccaggacccagggaactggaagccagcaaagtt
gtcctcctgcccagttgtcccggagctccaggaagtcctggggagaagggagccccaggt
cctcaagggccacctggaccaccaggcaagatgggccccaagggtgagccaggagatcca
gtgaacctgctccggtgccaggaaggccccagaaactgccgggagctgttgagccagggc
gccaccttgagcggctggtaccatctgtgcctacctgagggcagggccctcccagtcttt
tgtgacatggacaccgaggggggcggctggctggtgtttcagaggcgccaggatggttct
gtggatttcttccgctcttggtcctcctacagagcaggttttgggaaccaagagtctgaa
ttctggctgggaaatgagaatttgcaccagcttactctccagggtaactgggagctgcgg
gtagagctggaagactttaatggtaaccgtactttcgcccactatgcgaccttccgcctc
ctcggtgaggtagaccactaccagctggcactgggcaagttctcagagggcactgcaggg
gattccctgagcctccacagtgggaggccctttaccacctatgacgctgaccacgattca
agcaacagcaactgtgcagtgattgtccacggtgcctggtggtatgcatcctgttaccga
tcaaatctcaatggtcgctatgcagtgtctgaggctgccgcccacaaatatggcattgac
tgggcctcaggccgtggtgtgggccacccctaccgcagggttcggatgatgcttcgatag

KEGG   Homo sapiens (human): 10747
Entry
10747             CDS       T01001                                 
Symbol
MASP2, MAP-2, MAP19, MASP-2, MASP1P1, sMAP
Name
(RefSeq) MBL associated serine protease 2
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06513  Complement cascade
nt06514  Coagulation cascade
  Element
N01312  SARS-CoV-2 S to lectin pathway of complement cascade
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01491  Lectin pathway of complement cascade, C4/C2 to C3 convertase formation
N01520  Regulation of fibrinolytic system, C1INH
Disease
H00105  Mannose-binding lectin pathway component defects
Drug target
Narsoplimab: D11531
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10747 (MASP2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    10747 (MASP2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    10747 (MASP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10747 (MASP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     10747 (MASP2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   10747 (MASP2)
SSDB
Motif
Pfam: Trypsin CUB Sushi EGF_CA FXa_inhibition cEGF CUB_2 EGF EGF_3
Other DBs
NCBI-GeneID: 10747
NCBI-ProteinID: NP_006601
OMIM: 605102
HGNC: 6902
Ensembl: ENSG00000009724
Pharos: O00187(Tbio)
UniProt: O00187
Structure
LinkDB
Position
1:complement(11026523..11047239)
AA seq 686 aa
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTC
SALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPA
CSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLT
AAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA
AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIENIISDF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaggctgctgaccctcctgggccttctgtgtggctcggtggccacccccttgggcccg
aagtggcctgaacctgtgttcgggcgcctggcatcccccggctttccaggggagtatgcc
aatgaccaggagcggcgctggaccctgactgcaccccccggctaccgcctgcgcctctac
ttcacccacttcgacctggagctctcccacctctgcgagtacgacttcgtcaagctgagc
tcgggggccaaggtgctggccacgctgtgcgggcaggagagcacagacacggagcgggcc
cctggcaaggacactttctactcgctgggctccagcctggacattaccttccgctccgac
tactccaacgagaagccgttcacggggttcgaggccttctatgcagccgaggacattgac
gagtgccaggtggccccgggagaggcgcccacctgcgaccaccactgccacaaccacctg
ggcggtttctactgctcctgccgcgcaggctacgtcctgcaccgtaacaagcgcacctgc
tcagccctgtgctccggccaggtcttcacccagaggtctggggagctcagcagccctgaa
tacccacggccgtatcccaaactctccagttgcacttacagcatcagcctggaggagggg
ttcagtgtcattctggactttgtggagtccttcgatgtggagacacaccctgaaaccctg
tgtccctacgactttctcaagattcaaacagacagagaagaacatggcccattctgtggg
aagacattgccccacaggattgaaacaaaaagcaacacggtgaccatcacctttgtcaca
gatgaatcaggagaccacacaggctggaagatccactacacgagcacagcgcagccttgc
ccttatccgatggcgccacctaatggccacgtttcacctgtgcaagccaaatacatcctg
aaagacagcttctccatcttttgcgagactggctatgagcttctgcaaggtcacttgccc
ctgaaatcctttactgcagtttgtcagaaagatggatcttgggaccggccaatgcccgcg
tgcagcattgttgactgtggccctcctgatgatctacccagtggccgagtggagtacatc
acaggtcctggagtgaccacctacaaagctgtgattcagtacagctgtgaagagaccttc
tacacaatgaaagtgaatgatggtaaatatgtgtgtgaggctgatggattctggacgagc
tccaaaggagaaaaatcactcccagtctgtgagcctgtttgtggactatcagcccgcaca
acaggagggcgtatatatggagggcaaaaggcaaaacctggtgattttccttggcaagtc
ctgatattaggtggaaccacagcagcaggtgcacttttatatgacaactgggtcctaaca
gctgctcatgccgtctatgagcaaaaacatgatgcatccgccctggacattcgaatgggc
accctgaaaagactatcacctcattatacacaagcctggtctgaagctgtttttatacat
gaaggttatactcatgatgctggctttgacaatgacatagcactgattaaattgaataac
aaagttgtaatcaatagcaacatcacgcctatttgtctgccaagaaaagaagctgaatcc
tttatgaggacagatgacattggaactgcatctggatggggattaacccaaaggggtttt
cttgctagaaatctaatgtatgtcgacataccgattgttgaccatcaaaaatgtactgct
gcatatgaaaagccaccctatccaaggggaagtgtaactgctaacatgctttgtgctggc
ttagaaagtgggggcaaggacagctgcagaggtgacagcggaggggcactggtgtttcta
gatagtgaaacagagaggtggtttgtgggaggaatagtgtcctggggttccatgaattgt
ggggaagcaggtcagtatggagtctacacaaaagttattaactatattccctggatcgag
aacataattagtgatttttaa

DBGET integrated database retrieval system