KEGG   Homo sapiens (human): 4775
Entry
4775              CDS       T01001                                 
Symbol
NFATC3, NF-AT4c, NFAT4, NFATX, n339260
Name
(RefSeq) nuclear factor of activated T cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04148  Efferocytosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04625  C-type lectin receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05417  Lipid and atherosclerosis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling (cancer)
nt06528  Calcium signaling
nt06535  Efferocytosis
nt06537  TCR/BCR signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00487  BCR-PLCG-Calcineurin signaling pathway
N01647  Ca2+/CAM-CN signaling pathway
N01750  Find-me signal (S1P)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4775 (NFATC3)
   04310 Wnt signaling pathway
    4775 (NFATC3)
   04020 Calcium signaling pathway
    4775 (NFATC3)
   04022 cGMP-PKG signaling pathway
    4775 (NFATC3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    4775 (NFATC3)
  09143 Cell growth and death
   04218 Cellular senescence
    4775 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4775 (NFATC3)
   04660 T cell receptor signaling pathway
    4775 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    4775 (NFATC3)
   04659 Th17 cell differentiation
    4775 (NFATC3)
   04662 B cell receptor signaling pathway
    4775 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4775 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    4775 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4775 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4775 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    4775 (NFATC3)
   05161 Hepatitis B
    4775 (NFATC3)
   05163 Human cytomegalovirus infection
    4775 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4775 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    4775 (NFATC3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    4775 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4775 (NFATC3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4775 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 4775
NCBI-ProteinID: NP_775188
OMIM: 602698
HGNC: 7777
Ensembl: ENSG00000072736
LinkDB
Position
16:68085370..68229259
AA seq 1075 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQELDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSD
DQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCRDESVSKEQHM
IPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD
QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDRE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaccacaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaagtcacaaaaactatgaaggaacttgtgagattcctgaatctaaatatagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatctatctctcctaactgt
catcaagaattagatgcacatgaagatgacctacagataaatgacccagaacgggaattt
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagttggttctctgatgcatct
tcttgtgaatcgctttcacatatttatgatgatgtggactcagagttgaatgaagctgca
gcccgatttacccttggatcccctctgacttctcctggtggctctccagggggctgccct
ggagaagaaacttggcatcaacagtatggacttggacactcattatcacccaggcaatct
ccttgccactctcctagatccagtgtcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcccacatccccctgtgggaaacggaggcactccagtgctgaa
gtttgttatgctgggtccctttcaccccatcactcacctgttccttcacctggtcactcc
cccaggggaagtgtgacagaagatacgtggctcaatgcttctgtccatggtgggtcaggc
cttggccctgcagtttttccatttcagtactgtgtagagactgacatccctctcaaaaca
aggaaaacttctgaagatcaagctgccatactaccaggaaaattagagctgtgttcagat
gaccaagggagtttatcaccagcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatgtggtgatcagtttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccagctcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctact
gggggacatcctgttgtgaagctcctgggctataacgaaaagccaataaatctacaaatg
tttattgggacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagacagtcgctactgcaagccaagagataataattgccagtacaaaagtt
ctggaaattccacttcttcctgaaaataatatgtcagccagtattgattgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccagtggaaaagtcctt
tctctgcagatagcctctatacccgttgagtgctcccagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatggttgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaagataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagtt
ttgatgaagcaagaacacagagaagagattgatttgtcttcagttccatctttgcctgtg
cctcatcctgctcagacccagaggccttcctctgattcagggtgttcacatgacagtgta
ctgtcaggacagagaagtttgatttgctccatcccacaaacatatgcatccatggtgacc
tcatcccatctgccacagttgcagtgtagagatgagagtgttagtaaagaacagcatatg
attccttctccaattgtacaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgttgtgtacaatggaccaacttgtcttcctattaat
gctgcctctagtcaagaatttgattcagttttgtttcagcaggatgcaactctttctggt
ttagtgaatcttggctgtcaaccactgtcatccataccatttcattcttcaaattcaggc
tcaacaggacatctcttagcccatacacctcattctgtgcataccctgcctcatctgcaa
tcaatgggatatcattgttcaaatacaggacaaagatctctttcttctccagtggctgac
cagattacaggtcagccttcgtctcagttacaacctattacatatggtccttcacattca
gggtctgctacaacagcttccccagcagcttctcatcccttggctagttcaccgctttct
gggccaccatctcctcagcttcagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccgtctccagccaccagaatgcattctggacagcactcaactcaagcacaaagt
acgggccaggggggtctttctgcaccttcatccttaatatgtcacagtttgtgtgatcca
gcgtcatttccacctgatggggcaactgtgagcattaaacctgaaccagaagatcgagag
cctaactttgcaaccattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggagcaggggtgagcaggcaggctccc
ctcccgagtcctgagtccctggatttaggaagatctgatgggctctaa

DBGET integrated database retrieval system