KEGG   Homo sapiens (human): 4804
Entry
4804              CDS       T01001                                 
Symbol
NGFR, CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Name
(RefSeq) nerve growth factor receptor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa03265  Virion - Lyssavirus
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04215  Apoptosis - multiple species
hsa04722  Neurotrophin signaling pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00132  Amplified MYCN to transcriptional repression
Drug target
Cenegermin: D11028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03265 Virion - Lyssavirus
    4804 (NGFR)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4804 (NGFR)
   04014 Ras signaling pathway
    4804 (NGFR)
   04015 Rap1 signaling pathway
    4804 (NGFR)
   04151 PI3K-Akt signaling pathway
    4804 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4804 (NGFR)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    4804 (NGFR)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4804 (NGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4804 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4804 (NGFR)
   04090 CD molecules [BR:hsa04090]
    4804 (NGFR)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   4804 (NGFR)
CD molecules [BR:hsa04090]
 Proteins
  4804 (NGFR)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 4804
NCBI-ProteinID: NP_002498
OMIM: 162010
HGNC: 7809
Ensembl: ENSG00000064300
Pharos: P08138(Tchem)
UniProt: P08138
Structure
LinkDB
Position
17:49495293..49515008
AA seq 427 aa
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggaggcatgccccacaggcctgtacacacacagc
ggtgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgacgtggtgagcgcgacc
gagccgtgcaagccgtgcaccgagtgcgtggggctccagagcatgtcggcgccgtgcgtg
gaggccgacgacgccgtgtgccgctgcgcctacggctactaccaggatgagacgactggg
cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtgttctcctgccaggac
aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattccgacgaggccaaccac
gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctccgcgagtgc
acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtccaca
cccccagagggctcggacagcacagcccccagcacccaggagcctgaggcacctccagaa
caagacctcatagccagcacggtggcaggtgtggtgaccacagtgatgggcagctcccag
cccgtggtgacccgaggcaccaccgacaacctcatccctgtctattgctccatcctggct
gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcag
aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa
ctccacagcgacagtggcatctccgtggacagccagagcctgcatgaccagcagccccac
acgcagacagcctcgggccaggccctcaagggtgacggaggcctctacagcagcctgccc
ccagccaagcgggaggaggtggagaagcttctcaacggctctgcgggggacacctggcgg
cacctggcgggcgagctgggctaccagcccgagcacatagactcctttacccatgaggcc
tgccccgttcgcgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagccgacctcgtggagagtctgtgcagtgag
tccactgccacatccccggtgtga

DBGET integrated database retrieval system