KEGG   Homo sapiens (human): 5627
Entry
5627              CDS       T01001                                 

Gene name
PROS1, PROS, PS21, PS22, PS23, PS24, PS25, PSA, THPH5, THPH6
Definition
(RefSeq) protein S
  KO
K03908  protein S
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00223  Inherited thrombophilia
H01723  Deep vein thrombosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5627 (PROS1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 EGF_CA FXa_inhibition Gla cEGF EGF EGF_3 hEGF
Other DBs
NCBI-GeneID: 5627
NCBI-ProteinID: NP_000304
OMIM: 176880
HGNC: 9456
Ensembl: ENSG00000184500
Vega: OTTHUMG00000150354
Pharos: P07225(Tbio)
UniProt: P07225 A0A0S2Z4K3
LinkDB
Structure
PDB: 
1Z6C

Position
3q11.1
AA seq 676 aa
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE
VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE
KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV
DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND
IRAHSCPSVWKKTKNS
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgagggtcctgggtgggcgctgcggggcgctgctggcgtgtctcctcctagtgcttccc
gtctcagaggcaaactttttgtcaaagcaacaggcttcacaagtcctggttaggaagcgt
cgtgcaaattctttacttgaagaaaccaaacagggtaatcttgaaagagaatgcatcgaa
gaactgtgcaataaagaagaagccagggaggtctttgaaaatgacccggaaacggattat
ttttatccaaaatacttagtttgtcttcgctcttttcaaactgggttattcactgctgca
cgtcagtcaactaatgcttatcctgacctaagaagctgtgtcaatgccattccagaccag
tgtagtcctctgccatgcaatgaagatggatatatgagctgcaaagatggaaaagcttct
tttacttgcacttgtaaaccaggttggcaaggagaaaagtgtgaatttgacataaatgaa
tgcaaagatccctcaaatataaatggaggttgcagtcaaatttgtgataatacacctgga
agttaccactgttcctgtaaaaatggttttgttatgctttcaaataagaaagattgtaaa
gatgtggatgaatgctctttgaagccaagcatttgtggcacagctgtgtgcaagaacatc
ccaggagattttgaatgtgaatgccccgaaggctacagatataatctcaaatcaaagtct
tgtgaagatatagatgaatgctctgagaacatgtgtgctcagctttgtgtcaattaccct
ggaggttacacttgctattgtgatgggaagaaaggattcaaacttgcccaagatcagaag
agttgtgaggttgtttcagtgtgccttcccttgaaccttgacacaaagtatgaattactt
tacttggcggagcagtttgcaggggttgttttatatttaaaatttcgtttgccagaaatc
agcagattttcagcagaatttgatttccggacatatgattcagaaggcgtgatactgtac
gcagaatctatcgatcactcagcgtggctcctgattgcacttcgtggtggaaagattgaa
gttcagcttaagaatgaacatacatccaaaatcacaactggaggtgatgttattaataat
ggtctatggaatatggtgtctgtggaagaattagaacatagtattagcattaaaatagct
aaagaagctgtgatggatataaataaacctggacccctttttaagccggaaaatggattg
ctggaaaccaaagtatactttgcaggattccctcggaaagtggaaagtgaactcattaaa
ccgattaaccctcgtctagatggatgtatacgaagctggaatttgatgaagcaaggagct
tctggaataaaggaaattattcaagaaaaacaaaataagcattgcctggttactgtggag
aagggctcctactatcctggttctggaattgctcaatttcacatagattataataatgta
tccagtgctgagggttggcatgtaaatgtgaccttgaatattcgtccatccacgggcact
ggtgttatgcttgccttggtttctggtaacaacacagtgccctttgctgtgtccttggtg
gactccacctctgaaaaatcacaggatattctgttatctgttgaaaatactgtaatatat
cggatacaggccctaagtctatgttccgatcaacaatctcatctggaatttagagtcaac
agaaacaatctggagttgtcgacaccacttaaaatagaaaccatctcccatgaagacctt
caaagacaacttgccgtcttggacaaagcaatgaaagcaaaagtggccacatacctgggt
ggccttccagatgttccattcagtgccacaccagtgaatgccttttataatggctgcatg
gaagtgaatattaatggtgtacagttggatctggatgaagccatttctaaacataatgat
attagagctcactcatgtccatcagtttggaaaaagacaaagaattcttaa

DBGET integrated database retrieval system