KEGG   Homo sapiens (human): 64837
Entry
64837             CDS       T01001                                 

Gene name
KLC2
Definition
(RefSeq) kinesin light chain 2
  KO
K10407  kinesin light chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06465  Prion disease
  Element
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01017  Mutation-caused aberrant PSEN1 to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01202  Oligomeric conformation PrPc to anterograde axonal transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Disease
H02114  Spastic paraplegia, optic atrophy, and neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64837 (KLC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64837 (KLC2)
   05012 Parkinson disease
    64837 (KLC2)
   05014 Amyotrophic lateral sclerosis
    64837 (KLC2)
   05016 Huntington disease
    64837 (KLC2)
   05020 Prion disease
    64837 (KLC2)
   05022 Pathways of neurodegeneration - multiple diseases
    64837 (KLC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    64837 (KLC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    64837 (KLC2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     64837 (KLC2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     64837 (KLC2)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_MalT TPR_8 TPR_16 TPR_19 TPR_17 SNAP ANAPC3 PPR JIP_LZII Crescentin DUF627 TMF_TATA_bd TMF_DNA_bd Csm1_N YabA KASH_CCD Uso1_p115_C COG2
Other DBs
NCBI-GeneID: 64837
NCBI-ProteinID: NP_001128247
OMIM: 611729
HGNC: 20716
Ensembl: ENSG00000174996
Vega: OTTHUMG00000133757
Pharos: Q9H0B6(Tdark)
UniProt: Q9H0B6
LinkDB
Structure
PDB: 
3EDT 3CEQ

Position
11q13.2
AA seq 622 aa
MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCIL
LRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKL
QRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSP
GGGDVSGQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVA
TMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKE
AEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGP
DDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRK
QGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSL
RRSGSFGKLRDALRRSSEMLVKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTG
LSDSRTLSSSSMDLSRRSSLVG
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggccatgatggtgtttccgcgggaggagaagctgagccaggatgagatcgtgctgggc
accaaggctgtcatccagggactggagactctgcgtggggagcatcgtgccctgctggct
cctctggttgcacctgaggccggcgaagccgagcctggctcgcaggagcgctgcatcctc
ctgcgtcgctccctggaagccattgagcttgggctgggggaggcccaggtgatcttggca
ttgtcgagccacctgggggctgtagaatcagagaagcagaagctgcgggcgcaggtgcgg
cgtctggtgcaggagaaccagtggctgcgtgaggagctggcggggacacagcagaagctg
cagcgcagtgagcaggccgtggcccagctcgaggaggagaagcagcacttgctgttcatg
agccagatccgcaagttggatgaagacgcctcccctaacgaggagaagggggacgtcccc
aaagacacactggatgacctgttccccaatgaggatgagcagagcccagcccctagccca
ggaggaggggatgtgtctggtcagcatgggggctacgagatcccggcccggctccgcacc
ctgcacaacctggtgatccaatacgcctcacagggccgctacgaggtagctgtgccactc
tgcaagcaggcactcgaagacctggagaagacgtcaggccacgaccaccctgacgttgcc
accatgctgaacatcctggcactggtctatcgggatcagaacaagtacaaggaggctgcc
cacctgctcaatgatgctctggccatccgggagaaaacactgggcaaggaccacccagcc
gtggctgcgacactaaacaacctggcagtcctgtatggcaagaggggcaagtacaaggag
gctgagccattgtgcaagcgggcactggagatccgggagaaggtcctgggcaagtttcac
ccagatgtggccaagcagctcagcaacctggccctgctgtgccagaaccagggcaaagct
gaggaggtggaatattactatcggcgggcactggagatctatgctacacgcctcgggccc
gatgaccccaatgtggccaagaccaagaacaacctggcttcctgctacctgaagcagggc
aagtaccaggatgcggagaccttgtacaaggagatcctcacccgcgctcatgagaaagag
tttggctctgtcaatggggacaacaagcccatctggatgcacgcagaggagcgggaggaa
agcaaggataagcgccgggacagcgccccctatggggaatacggcagctggtacaaggcc
tgtaaagtagacagccccacagtcaacaccaccctgcgcagcttgggggccctataccgg
cgccagggcaagctggaagccgcgcacacactagaggactgtgccagccgtaaccgcaag
cagggtttggaccccgcaagccagaccaaggtggtagaactgctgaaagatggcagtggc
aggcggggagaccgccgcagcagccgagacatggctgggggtgccgggcctcggtctgag
tctgacctcgaggacgtgggacctacagctgagtggaatggggatggcagtggctccttg
aggcgcagcggttcctttgggaaactccgggatgccctgaggcgcagcagtgagatgctg
gtaaagaagctgcaggggggcaccccccaggagccccctaaccccaggatgaagcgggcc
agttccctcaacttcctcaacaagagcgtggaagagccgacccagcctggaggcacaggt
ctctctgacagccgcactctcagctccagctccatggacctctcccgacgaagctccctg
gtgggctaa

DBGET integrated database retrieval system