KEGG   Homo sapiens (human): 712
Entry
712               CDS       T01001                                 

Gene name
C1QA
Definition
(RefSeq) complement C1q A chain
  KO
K03986  complement C1q subcomponent subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H01357  Allergic contact dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    712 (C1QA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    712 (C1QA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    712 (C1QA)
   05150 Staphylococcus aureus infection
    712 (C1QA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    712 (C1QA)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    712 (C1QA)
  09164 Neurodegenerative disease
   05020 Prion disease
    712 (C1QA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    712 (C1QA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    712 (C1QA)
SSDB
Motif
Pfam: C1q Collagen TNF
Other DBs
NCBI-GeneID: 712
NCBI-ProteinID: NP_001334394
OMIM: 120550
HGNC: 1241
Ensembl: ENSG00000173372
Vega: OTTHUMG00000002893
Pharos: P02745(Tbio)
UniProt: P02745 A0A024RAG6
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 245 aa
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR
TGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI
RRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR
GQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagggtccccggggatggctggtgctctgtgtgctggccatatcgctggcctctatg
gtgaccgaggacttgtgccgagcaccagacgggaagaaaggggaggcaggaagacctggc
agacgggggcggccaggcctcaagggggagcaaggggagccgggggcccctggcatccgg
acaggcatccaaggccttaaaggagaccagggggaacctgggccctctggaaaccccggc
aaggtgggctacccagggcccagcggccccctcggagcccgtggcatcccgggaattaaa
ggcaccaagggcagcccaggaaacatcaaggaccagccgaggccagccttctccgccatt
cggcggaaccccccaatggggggcaacgtggtcatcttcgacacggtcatcaccaaccag
gaagaaccgtaccagaaccactccggccgattcgtctgcactgtacccggctactactac
ttcaccttccaggtgctgtcccagtgggaaatctgcctgtccatcgtctcctcctcaagg
ggccaggtccgacgctccctgggcttctgtgacaccaccaacaaggggctcttccaggtg
gtgtcagggggcatggtgcttcagctgcagcagggtgaccaggtctgggttgaaaaagac
cccaaaaagggtcacatttaccagggctctgaggccgacagcgtcttcagcggcttcctc
atcttcccatctgcctga

KEGG   Homo sapiens (human): 713
Entry
713               CDS       T01001                                 

Gene name
C1QB
Definition
(RefSeq) complement C1q B chain
  KO
K03987  complement C1q subcomponent subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    713 (C1QB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    713 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    713 (C1QB)
   05150 Staphylococcus aureus infection
    713 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    713 (C1QB)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    713 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion disease
    713 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    713 (C1QB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    713 (C1QB)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 713
NCBI-ProteinID: NP_000482
OMIM: 120570
HGNC: 1242
Ensembl: ENSG00000173369
Vega: OTTHUMG00000002896
Pharos: P02746(Tbio)
UniProt: P02746 A0A024RAB9
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 253 aa
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgatgatgaagatcccatggggcagcatcccagtactgatgttgctcctgctcctgggc
ctaatcgatatctcccaggcccagctcagctgcaccgggcccccagccatccctggcatc
ccgggtatccctgggacacctggccccgatggccaacctgggaccccagggataaaagga
gagaaagggcttccagggctggctggagaccatggtgagttcggagagaagggagaccca
gggattcctgggaatccaggaaaagtcggccccaagggccccatgggccctaaaggtggc
ccaggggcccctggagccccaggccccaaaggtgaatcgggagactacaaggccacccag
aaaatcgccttctctgccacaagaaccatcaacgtccccctgcgccgggaccagaccatc
cgcttcgaccacgtgatcaccaacatgaacaacaattatgagccccgcagtggcaagttc
acctgcaaggtgcccggtctctactacttcacctaccacgccagctctcgagggaacctg
tgcgtgaacctcatgcgtggccgggagcgtgcacagaaggtggtcaccttctgtgactat
gcctacaacaccttccaggtcaccaccggtggcatggtcctcaagctggagcagggggag
aacgtcttcctgcaggccaccgacaagaactcactactgggcatggagggtgccaacagc
atcttttccgggttcctgctctttccagatatggaggcctga

KEGG   Homo sapiens (human): 714
Entry
714               CDS       T01001                                 

Gene name
C1QC, C1Q-C, C1QG
Definition
(RefSeq) complement C1q C chain
  KO
K03988  complement C1q subcomponent subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    714 (C1QC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    714 (C1QC)
  09171 Infectious disease: bacterial
   05133 Pertussis
    714 (C1QC)
   05150 Staphylococcus aureus infection
    714 (C1QC)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    714 (C1QC)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    714 (C1QC)
  09164 Neurodegenerative disease
   05020 Prion disease
    714 (C1QC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    714 (C1QC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    714 (C1QC)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 714
NCBI-ProteinID: NP_001107573
OMIM: 120575
HGNC: 1245
Ensembl: ENSG00000159189
Vega: OTTHUMG00000002891
Pharos: P02747(Tbio)
UniProt: P02747 A0A024RAA7
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 245 aa
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS
VFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV
LLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF
LLFPD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggacgtggggcccagctccctgccccaccttgggctgaagctgctgctgctcctgctg
ctgctgcccctcaggggccaagccaacacaggctgctacgggatcccagggatgcccggc
ctgcccggggcaccagggaaggatgggtacgacggactgccggggcccaagggggagcca
ggaatcccagccattcccgggatccgaggacccaaagggcagaagggagaacccggctta
cccggccatcctgggaaaaatggccccatgggaccccctgggatgccaggggtgcccggc
cccatgggcatccctggagagccaggtgaggagggcagatacaagcagaaattccagtca
gtgttcacggtcactcggcagacccaccagccccctgcacccaacagcctgatcagattc
aacgcggtcctcaccaacccgcagggagattatgacacgagcactggcaagttcacctgc
aaagtccccggcctctactactttgtctaccacgcgtcgcatacagccaacctgtgcgtg
ctgctgtaccgcagcggcgtcaaagtggtcaccttctgtggccacacgtccaaaaccaat
caggtcaactcgggcggtgtgctgctgaggttgcaggtgggcgaggaggtgtggctggct
gtcaatgactactacgacatggtgggcatccagggctctgacagcgtcttctccggcttc
ctgctcttccccgactag

DBGET integrated database retrieval system