KEGG   Homo sapiens (human): 7293
Entry
7293              CDS       T01001                                 
Symbol
TNFRSF4, ACT35, CD134, IMD16, OX40, TXGP1L
Name
(RefSeq) TNF receptor superfamily member 4
  KO
K05142  tumor necrosis factor receptor superfamily member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00093  Combined immunodeficiency
Drug target
Tavolimab: D11301
Vonlerolizumab: D11268
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7293 (TNFRSF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7293 (TNFRSF4)
   04090 CD molecules [BR:hsa04090]
    7293 (TNFRSF4)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   7293 (TNFRSF4)
CD molecules [BR:hsa04090]
 Proteins
  7293 (TNFRSF4)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 7293
NCBI-ProteinID: NP_003318
OMIM: 600315
HGNC: 11918
Ensembl: ENSG00000186827
Pharos: P43489(Tbio)
UniProt: P43489
Structure
LinkDB
Position
1:complement(1211340..1214153)
AA seq 277 aa
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ
NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK
PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ
GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL
RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtgcgtgggggctcggcggctgggccgcgggccgtgtgcggctctgctcctcctgggc
ctggggctgagcaccgtgacggggctccactgtgtcggggacacctaccccagcaacgac
cggtgctgccacgagtgcaggccaggcaacgggatggtgagccgctgcagccgctcccag
aacacggtgtgccgtccgtgcgggccgggcttctacaacgacgtggtcagctccaagccg
tgcaagccctgcacgtggtgtaacctcagaagtgggagtgagcggaagcagctgtgcacg
gccacacaggacacagtctgccgctgccgggcgggcacccagcccctggacagctacaag
cctggagttgactgtgccccctgccctccagggcacttctccccaggcgacaaccaggcc
tgcaagccctggaccaactgcaccttggctgggaagcacaccctgcagccggccagcaat
agctcggacgcaatctgtgaggacagggaccccccagccacgcagccccaggagacccag
ggccccccggccaggcccatcactgtccagcccactgaagcctggcccagaacctcacag
ggaccctccacccggcccgtggaggtccccgggggccgtgcggttgccgccatcctgggc
ctgggcctggtgctggggctgctgggccccctggccatcctgctggccctgtacctgctc
cggagggaccagaggctgccccccgatgcccacaagccccctgggggaggcagtttccgg
acccccatccaagaggagcaggccgacgcccactccaccctggccaagatctga

DBGET integrated database retrieval system