KEGG   Homo sapiens (human): 7385
Entry
7385              CDS       T01001                                 
Symbol
UQCRC2, MC3DN5, QCR2, UQCR2
Name
(RefSeq) ubiquinol-cytochrome c reductase core protein 2
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
N01395  Cadmium to electron transfer in complex III
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7385 (UQCRC2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7385 (UQCRC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    7385 (UQCRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    7385 (UQCRC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7385 (UQCRC2)
   05012 Parkinson disease
    7385 (UQCRC2)
   05014 Amyotrophic lateral sclerosis
    7385 (UQCRC2)
   05016 Huntington disease
    7385 (UQCRC2)
   05020 Prion disease
    7385 (UQCRC2)
   05022 Pathways of neurodegeneration - multiple diseases
    7385 (UQCRC2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7385 (UQCRC2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7385 (UQCRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7385 (UQCRC2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M16: pitrilysin family
   7385 (UQCRC2)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C YdgH_BhsA-like
Other DBs
NCBI-GeneID: 7385
NCBI-ProteinID: NP_003357
OMIM: 191329
HGNC: 12586
Ensembl: ENSG00000140740
Pharos: P22695(Tbio)
UniProt: P22695
Structure
LinkDB
Position
16:21953361..21983660
AA seq 453 aa
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSR
IGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAA
AYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNM
RGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK
RGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKT
IAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVA
NADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagctactaaccagagccggctctttctcgagattttattccctcaaagttgccccc
aaagttaaagccacagctgcgcctgcaggagcaccgccacaacctcaggaccttgagttt
accaagttaccaaatggcttggtgattgcttctttggaaaactattctcctgtatcaaga
attggtttgttcattaaagcaggcagtagatatgaggacttcagcaatttaggaaccacc
catttgctgcgtcttacatccagtctgacgacaaaaggagcttcatctttcaagataacc
cgtggaattgaagcagttggtggcaaattaagtgtgaccgcaacaagggaaaacatggct
tatactgtggaatgcctgcggggtgatgttgatattctaatggagttcctgctcaatgtc
accacagcaccagaatttcgtcgttgggaagtagctgaccttcagcctcagctaaagatt
gacaaagctgtggcctttcagaatccgcagactcatgtcattgaaaatttgcatgcagca
gcttaccggaatgccttggctaatcccttgtattgtcctgactataggattggaaaagtg
acatcagaggagttacattacttcgttcagaaccatttcacaagtgcaagaatggctttg
attggacttggtgtgagtcatcctgttctaaagcaagttgctgaacagtttctcaacatg
aggggtgggcttggtttatctggtgcaaaggccaactaccgtggaggtgaaatccgagaa
cagaatggagacagtcttgtccatgctgcttttgtagcagaaagtgctgtcgcgggaagt
gcagaggcaaatgcatttagtgttcttcagcatgtcctcggtgctgggccacatgtcaag
aggggcagcaacaccaccagccatctgcaccaggctgttgccaaggcaactcagcagcca
tttgatgtttctgcatttaatgccagttactcagattctggactctttgggatttatact
atctcccaggccacagctgctggagatgttatcaaggctgcctataatcaagtaaaaaca
atagctcaaggaaacctttccaacacagatgtccaagctgccaagaacaagctgaaagct
ggatacctaatgtcagtggagtcttctgagtgtttcctggaagaagtcgggtcccaggct
ctagttgctggttcttacatgccaccatccacagtccttcagcagattgattcagtggct
aatgctgatatcataaatgcggcaaagaagtttgtttctggccagaagtcaatggcagca
agtggaaatttgggacatacaccttttgttgatgagttgtaa

DBGET integrated database retrieval system