KEGG   Homo sapiens (human): 89953
Entry
89953             CDS       T01001                                 

Gene name
KLC4, KNSL8, bA387M24.3
Definition
(RefSeq) kinesin light chain 4
  KO
K10407  kinesin light chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06465  Prion disease
  Element
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01017  Mutation-caused aberrant PSEN1 to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01202  Oligomeric conformation PrPc to anterograde axonal transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    89953 (KLC4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    89953 (KLC4)
   05012 Parkinson disease
    89953 (KLC4)
   05014 Amyotrophic lateral sclerosis
    89953 (KLC4)
   05016 Huntington disease
    89953 (KLC4)
   05020 Prion disease
    89953 (KLC4)
   05022 Pathways of neurodegeneration - multiple diseases
    89953 (KLC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    89953 (KLC4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    89953 (KLC4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     89953 (KLC4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     89953 (KLC4)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_16 TPR_19 TPR_14 TPR_17 ANAPC3 PPR JIP_LZII RPN7 Crescentin Uso1_p115_C TMF_TATA_bd LUD_dom TMF_DNA_bd Csm1_N
Other DBs
NCBI-GeneID: 89953
NCBI-ProteinID: NP_001275963
HGNC: 21624
Ensembl: ENSG00000137171
Vega: OTTHUMG00000014720
Pharos: Q9NSK0(Tdark)
UniProt: Q9NSK0 A0A024RCZ8
LinkDB
Position
6p21.1
AA seq 619 aa
MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIECLQQGGHE
EGLVHEKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLR
DELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYDEDGHTSEEKEGDATKDSLDDLFP
NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED
LERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNN
LAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYY
QRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAHVQEFGSVDDD
HKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKL
EAAETLEECALRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGGEDASVAVE
WSGDGSGTLQRSGSLGKIRDVLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLNQPSAA
PLQVSRGLSASTMDLSSSS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtcaggcctggtgttggggcagcgggatgagcctgcaggccaccggctcagccaagag
gagatcctggggagcacacggctggtcagccaagggctagaggccctacgcagtgaacac
caggccgtgctgcaaagcctgtcccagaccattgagtgtctgcagcagggaggccatgag
gaagggctggtgcatgagaaggcccggcagcttcgccgttctatggaaaacattgagctc
gggctgagtgaggcccaggtgatgctggctctagccagccacctgagcacagtggagtcg
gagaaacagaagctgcgggctcaggtgcggcggctatgccaggagaaccagtggctgcgg
gatgagctggctggcacccagcagcggctacagcgcagtgaacaggctgtggctcagctg
gaggaggaaaagaagcacctggagttcctggggcagctgcggcagtatgatgaggatgga
catacctcggaggagaaagaaggcgatgccaccaaggattccctggatgacctctttcct
aatgaggaggaagaggaccccagcaatggcttgtcccgtggtcaaggtgctacagcagct
cagcagggtggatatgagatcccagcaaggttgcggacgttgcacaacctggtgatccag
tacgcagcccaaggtcgctatgaggtggccgtgccactctgtaagcaggcactagaggac
ctggagcgcacatcaggccgtggccaccctgatgtcgccaccatgctcaacatccttgct
ttggtgtatcgtgaccagaataagtataaggaagctgcccacctgctgaatgatgccctt
agcatccgggagagcaccttgggacctgaccatcctgctgtggctgccacactcaacaat
ttggctgtgctctatggcaaaaggggcaagtacaaggaggcagagcctctgtgccagcgg
gcactggagattcgagaaaaggtcctgggcacgaatcatccagatgtggcaaaacagctg
aacaacctggccctcttgtgccaaaaccagggcaagtatgaggccgtggaacgctactac
cagcgagcactggccatctacgaggggcagctggggccggacaaccctaatgtagcccgg
accaagaacaacctggcttcctgttacctgaaacagggcaaatatgctgaggctgagaca
ctatacaaagagatcctgacccgtgcccatgtacaggagtttgggtctgtggatgatgac
cacaagcccatctggatgcatgcagaggagcgggaggaaatgagcaaaagccggcaccat
gagggtgggacaccctatgctgagtatggaggctggtacaaggcctgcaaagtgagcagc
cccacagtgaacactactctgagaaacctgggagctctgtataggcgccagggaaagctg
gaggctgctgagaccctggaggaatgtgccctgcggtcccggagacagggcactgaccct
atcagccagacgaaggtggcagagctgcttggggagagtgatggtagaaggacctcccag
gagggccctggagacagtgtgaaattcgagggaggtgaagatgcttctgtggctgtggag
tggtccggggatggcagtgggaccctgcagaggagtggctctcttggcaagatccgggat
gtgctccgcagaagcagtgaactcttggtgaggaagctccaggggactgagcctcggccc
tccagcagcaacatgaagcgagcagcctccttgaactatctgaaccaacctagtgcagca
cccctccaggtctcccggggcctcagtgccagcaccatggacctctcttcaagcagctga

DBGET integrated database retrieval system