KEGG   Homo sapiens (human): 92
Entry
92                CDS       T01001                                 
Symbol
ACVR2A, ACTRII, ACVR2
Name
(RefSeq) activin A receptor type 2A
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06507  TGFB signaling
  Element
N01426  BMP9/10 signaling pathway
N01453  BMP signaling pathway
N01456  Activin signaling pathway
N01459  Nodal signaling pathway
N01462  BMP9/10 signaling pathway, BMP9/10 coreceptor
Drug target
Bimagrumab: D10620
Sotatercept: D09670
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    92 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    92 (ACVR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    92 (ACVR2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    92 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    92 (ACVR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     92 (ACVR2A)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   92 (ACVR2A)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal APH QVR
Other DBs
NCBI-GeneID: 92
NCBI-ProteinID: NP_001265508
OMIM: 102581
HGNC: 173
Ensembl: ENSG00000121989
Pharos: P27037(Tbio)
UniProt: P27037
Structure
LinkDB
Position
2:147844517..147930822
AA seq 513 aa
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcctgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtcttttctttaatgctaattgggaaaaagac
agaaccaatcaaactggtgttgaaccgtgttatggtgacaaagataaacggcggcattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaaacaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtgtagaaaaaaaagacagccctgaagta
tatttttgttgctgtgagggcaatatgtgtaatgaaaagttttcttattttccggagatg
gaagtcacacagcccacttcaaatccagttacacctaagccaccctattacaacatcctg
ctctattccttggtgccacttatgttaattgcggggattgtcatttgtgcattttgggtg
tacaggcatcacaagatggcctaccctcctgtacttgttccaactcaagacccaggacca
cccccaccttctccattactaggtttgaaaccactgcagttattagaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgcttaacgaatatgtggctgtcaaaata
tttccaatacaggacaaacagtcatggcaaaatgaatacgaagtctacagtttgcctgga
atgaagcatgagaacatattacagttcattggtgcagaaaaacgaggcaccagtgttgat
gtggatctttggctgatcacagcatttcatgaaaagggttcactatcagactttcttaag
gctaatgtggtctcttggaatgaactgtgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcctaaaagatggccacaaacctgccatatctcac
agggacatcaaaagtaaaaatgtgctgttgaaaaacaacctgacagcttgcattgctgac
tttgggttggccttaaaatttgaggctggcaagtctgcaggcgatacccatggacaggtt
ggtacccggaggtacatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtatgccatgggattagtcctatgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgaatacatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagacatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ttaagagattattggcagaaacatgctggaatggcaatgctctgtgaaaccattgaagaa
tgttgggatcacgacgcagaagccaggttatcagctggatgtgtaggtgaaagaattacc
cagatgcagagactaacaaatattattaccacagaggacattgtaacagtggtcacaatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

DBGET integrated database retrieval system