KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330940
Entry
4330940           CDS       T01015                                 
Name
(RefSeq) alpha-aminoadipic semialdehyde synthase
  KO
K14157  alpha-aminoadipic semialdehyde synthase [EC:1.5.1.8 1.5.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00310  Lysine degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    4330940
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.8  saccharopine dehydrogenase (NADP+, L-lysine-forming)
     4330940
    1.5.1.9  saccharopine dehydrogenase (NAD+, L-glutamate-forming)
     4330940
SSDB
Motif
Pfam: Sacchrp_dh_C AlaDh_PNT_N Saccharop_dh_N Sacchrp_dh_NADP AlaDh_PNT_C GFO_IDH_MocA
Other DBs
NCBI-GeneID: 4330940
NCBI-ProteinID: XP_015626026
UniProt: E3WF37
LinkDB
Position
2:complement(33253177..33266577)
AA seq 1061 aa
MGSAGNENSDTLLGNGVVGILAETANMWERRAPLTPSHCARLLLGGGKRGTGVNRIIVQP
STKRIHHDAQYEDVGCEISKDLSECGLIIGIKQPKLEMILPHRAYGFFSHTHKAQKENMP
LLDEILEKRVSLFDYELIAGDDGKRLLAFGKFAGRAGLIDFLHGLGQRYLSLGYSTPFLS
LGQSHMYPSLAAAKAAVIAIGEEIATFGLPSGICPIVFVFTGTGNVSQGAQEIFKLLPHS
FVDAGKLPELSAARSLSQHPQSSKRVFQLYGCVVSSRDMVTPKDPTRCFNKADYYAHPEH
YKPVFHERIAPYASAIVNCMYWERRFPRLLSIDQLQQLMKNGCPLVGISDITCDIGGSIE
FVNKSTSIERPFFRYDPCTNSCHDDMEGNGVICLAVDILPTEFSKEASQHFGDILSKFVA
RLASAKELLELPSHLRKACIAHAGRLTSLYEYIPRMRKTIIELPPAPTNLLPDKKYNSLV
SLSGHLFDKFLINEALDIIETAGGSFHLIRCDVGQSIDDMSYSELEVGADDTATLDKIID
SLTSLANAHGDPNARREIELSLKIGKVNECGTDDSMAKEGSKVLILGAGRVCRPAAEFLA
SYSNIFSSSAYDHDIDQIHVIVASLYQKDAEETIDGIRNATAAQLDVADIKNLSNLVSQV
EVVVSLLPASFHAAIARVCIEMKKHLVTASYVDESMSKLEQSAEGAGVTILCEMGLDPGI
DHMMSMKMIDEAHSRKGKIKSFTSFCGGLPSPASANNPLAYKFSWSPAGAIRAGRNPAVY
KFHGEIIHVDGDKLYESAKRLRLPELPAFALEHLPNRNSLMYGDLYGISKEASTVYRATL
RYEGFSEIMATFAKIGFFDAASHPLLQQTTRPTYRDFLVELFNACNISTTARKEYSEVSG
GQDGELISRLLSFGHCKDKEIAAKTVKTIKFLGLYEETQIPENCSSAFDVICQRMEQRMA
YIHNEQDMVLLHHEVEVEYPDGRPTEKHQATLLEFGKVENGRPTTAMALTVGIPAAIGAL
LLLQNKIQKKGVIRPLEPEIYIPALEILESSGIKLAERVET
NT seq 3186 nt   +upstreamnt  +downstreamnt
atgggttctgcgggaaatgaaaacagtgacacattactaggcaatggagttgttgggatt
cttgccgagactgctaatatgtgggaaaggagagcaccattaaccccatcccattgtgct
cgccttctgcttggaggaggcaagaggggaactggggtaaatcggattatcgtgcaacca
agtacaaagaggatccatcatgatgctcaatacgaggatgttgggtgtgagatttcaaaa
gacctgtcagagtgtggtcttattataggaatcaaacaaccaaagctggagatgattctt
ccacatagagcatatggattcttttctcacacccataaggcccagaaagaaaatatgcca
ctattagatgagatccttgaaaaaagagtatccctgtttgattatgagctaattgctgga
gatgatgggaaaagattgcttgcatttgggaaatttgctgggagagctggactgatagac
ttcttacacggtctcggacaacggtacttgagccttggatactcgaccccatttctctct
ctagggcaatcacatatgtatccttcactcgctgcagccaaggctgcagtcattgccatt
ggtgaagagatagcaacatttggacttccatctggaatttgcccaatagtatttgtattc
actggaactggaaatgtttctcagggtgcgcaagagatattcaagttactgccccatagc
tttgttgatgctgggaagcttccagagctttctgcggctagaagtctgtctcaacatcca
caatcaagcaagagagtattccagctgtatggttgtgttgtctcttctagagacatggtc
actcccaaggatcccaccagatgcttcaacaaagctgactattatgctcatccagaacac
tacaagcctgtttttcatgaaaggattgctccatatgcatctgccattgttaactgcatg
tactgggagaggaggtttccacgattactgagcattgaccagttacaacaactgatgaag
aatggttgccctttggttggtatttctgatataacttgtgacattggaggttccatagaa
tttgtgaacaagagtacttcaattgagagacctttcttcaggtatgatccttgtactaat
tcatgccatgatgatatggaaggaaatggtgtgatctgcttagccgttgacattctccct
acagaattttccaaagaggcctcccaacattttggagacatattatccaaattcgttgct
agattggcctcagctaaggaactgttggagcttccttcacacttgagaaaagcttgcatt
gcgcatgctggcagactcacttctctgtatgagtatattcctcggatgagaaagactata
atagagttgccaccagctccaacaaatctattacctgataagaagtacaacagcctggtg
tctctcagtggccacctctttgataagttccttattaatgaagctctggatattattgaa
acagccggaggttcttttcacttgattagatgcgatgttgggcaaagcattgatgatatg
tcatactcagagcttgaagtaggagcagatgatacagctacattggataagattattgat
tccttgacttctctagctaatgcacatggagatcctaatgccagaagagaaattgaatta
tctctaaagataggaaaagtcaatgagtgtggaactgatgacagcatggctaaagaaggg
tcaaaggttttaattcttggagctggaagagtctgtcgaccagctgctgagtttctggct
tcttattcaaacatcttcagcagcagtgcctacgatcatgacattgaccaaattcatgtt
attgtggcgtccctgtaccaaaaagatgcagaagagacaattgatggcataagaaatgca
acagctgctcaactcgatgttgcagatattaaaaatctttccaatcttgtttctcaggtt
gaagtagtagttagcttgctgcctgccagttttcatgctgccatagcaagagtatgcata
gagatgaagaagcacttggtcactgcaagctatgttgatgagtccatgtcaaagttggaa
caatctgcagaaggtgctggtgtaactattctctgtgaaatgggcctggatcctggcata
gatcatatgatgtcaatgaagatgattgacgaagcacattcacggaaggggaaaataaag
tcatttacatccttttgtggaggacttccatctccagcttctgcaaacaatccacttgct
tataagttcagttggagtccagctggtgccatccgtgcagggagaaaccctgctgtctac
aaatttcatggagaaatcatccatgtagatggtgataaattgtatgaatccgcaaagagg
ctcagattaccagaacttccagcttttgcactggaacacttgccaaaccggaattccttg
atgtatggagacctgtatgggatctccaaagaagcatctactgtgtacagggctactctt
cgttatgaaggatttagtgagataatggcaaccttcgcgaaaattgggttttttgatgct
gcaagtcatccactgttgcaacaaactactcgccctacatacagggattttcttgttgaa
ctcttcaatgcttgtaacatctccacaaccgccagaaaggaatatagtgaagtctctgga
ggacaagatggtgaactgatttccagactcttgagttttgggcattgcaaagataaggaa
atagctgctaagacagtcaaaacaatcaagttcttgggattatatgaggagacacagatt
ccagagaactgttcaagtgcatttgatgtgatttgccagcgaatggagcagagaatggct
tatatccacaatgagcaggatatggtactgctgcaccatgaggtggaggtggaataccct
gatggccgaccaaccgaaaagcaccaagcaaccctacttgagtttggaaaggttgaaaat
ggcaggcctaccactgccatggctctcacggtcggaataccagcagcaataggagctctg
ctgttgctccagaacaagatccaaaagaaaggagtgatcaggcctctggaacctgaaatt
tacattccagcgttggagatcttggagtcatcgggtatcaagctggcggagagagtggag
acctga

DBGET integrated database retrieval system