KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344702
Entry
4344702           CDS       T01015                                 
Name
(RefSeq) flavone 3'-O-methyltransferase 1
  KO
K13066  caffeic acid 3-O-methyltransferase / acetylserotonin O-methyltransferase [EC:2.1.1.68 2.1.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00380  Tryptophan metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00936  Melatonin biosynthesis, plants, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    4344702
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4344702
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.4  acetylserotonin O-methyltransferase
     4344702
    2.1.1.68  caffeate O-methyltransferase
     4344702
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation Methyltransf_PK DUF3189 Bin3
Other DBs
NCBI-GeneID: 4344702
NCBI-ProteinID: XP_015650053
UniProt: Q6ZD89
LinkDB
Position
8:complement(3337794..3340954)
AA seq 368 aa
MGSTAADMAAAADEEACMYALQLASSSILPMTLKNAIELGLLETLQSAAVAGGGGKAALL
TPAEVADKLPSKANPAAADMVDRMLRLLASYNVVRCEMEEGADGKLSRRYAAAPVCKWLT
PNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDARFNRVF
NEGMKNHSVIITKKLLDLYTGFDAASTVVDVGGGVGATVAAVVSRHPHIRGINYDLPHVI
SEAPPFPGVEHVGGDMFASVPRGGDAILMKWILHDWSDEHCARLLKNCYDALPEHGKVVV
VECVLPESSDATAREQGVFHVDMIMLAHNPGGKERYEREFRELARAAGFTGFKATYIYAN
AWAIEFTK
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgggttctacagccgccgacatggccgcggcggccgacgaggaggcgtgcatgtacgcg
ctgcagctggcgtcgtcgtcgatcctgccgatgacgctcaagaacgccatcgagctgggc
ctgctcgagacgctgcagtccgccgccgtcgccggaggaggggggaaggcggcgctgctg
acgccggcggaggtggccgacaagctgccgtccaaggcgaacccggcggcggccgacatg
gtggaccgcatgctccgcctgctcgcctcctacaacgtcgtcaggtgcgagatggaggag
ggcgccgacggcaagctctcccgccgctacgccgccgcgccggtgtgcaagtggctgacg
cccaacgaggacggcgtctccatggccgccctcgccctcatgaaccaggacaaggtcctc
atggagagctggtactaccttaaggacgcagtcctggacggcggcatcccgttcaacaag
gcgtacgggatgacggcgttcgagtaccacggcacggacgcccgcttcaaccgcgtcttc
aacgagggcatgaagaaccactccgtcatcatcaccaagaagctgctcgacctctacacc
ggcttcgacgccgcctccaccgtcgtcgacgtcggcggcggcgtgggcgccactgtggcc
gccgtcgtctcccgccacccgcacatccgggggatcaactacgacctcccccacgtcatc
tccgaggcgccgccgttccccggggtggagcacgtcggcggcgacatgttcgcctccgtg
ccccgcggcggcgacgccatcctgatgaagtggatcctccacgactggagcgacgagcac
tgcgcgcggctgctcaagaactgctacgacgcgctgccggagcacgggaaggtggtggtg
gtggagtgcgtgctgccggagagctccgacgcgacggcgagggagcagggggtgttccac
gtcgacatgatcatgctcgcccacaaccccggcggcaaggagaggtacgagagggagttc
agggagctcgcccgcgccgccggattcaccggcttcaaggccacctacatctacgccaac
gcctgggccatcgagttcaccaagtag

DBGET integrated database retrieval system