KEGG   Homo sapiens (human): 10038
Entry
10038             CDS       T01001                                 

Gene name
PARP2, ADPRT2, ADPRTL2, ADPRTL3, ARTD2, PARP-2, pADPRT-2
Definition
(RefSeq) poly(ADP-ribose) polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04210  Apoptosis
Drug target
Niraparib (DG03120): D10140 D11895<JP/US>
Olaparib: D09730<JP/US>
Pamiparib: D11426
Rucaparib (DG01864): D10079 D10157 D10982<US>
Talazoparib (DG01865): D10732 D10733<US>
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    10038 (PARP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    10038 (PARP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10038 (PARP2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10038 (PARP2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10038 (PARP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     10038 (PARP2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     10038 (PARP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    10038 (PARP2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     10038 (PARP2)
SSDB
Motif
Pfam: PARP PARP_reg WGR
Other DBs
NCBI-GeneID: 10038
NCBI-ProteinID: NP_005475
OMIM: 607725
HGNC: 272
Ensembl: ENSG00000129484
Vega: OTTHUMG00000166106
Pharos: Q9UGN5(Tclin)
UniProt: Q9UGN5
LinkDB
Structure
PDB: 

Position
14q11.2
AA seq 583 aa
MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKD
RTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLN
QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKF
LDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQE
LIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALME
ACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQ
HYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDL
HNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLK
NTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGP
ASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcggcgcggcggcgacggagcaccggcggcggcagggcgagagcattaaatgaaagc
aaaagagttaataatggcaacacggctccagaagactcttcccctgccaagaaaactcgt
agatgccagagacaggagtcgaaaaagatgcctgtggctggaggaaaagctaataaggac
aggacagaagacaagcaagatggtatgccaggaaggtcatgggccagcaaaagggtctct
gaatctgtgaaggccttgctgttaaagggcaaagctcctgtggacccagagtgtacagcc
aaggtggggaaggctcatgtgtattgtgaaggaaatgatgtctatgatgtcatgctaaat
cagaccaatctccagttcaacaacaacaagtactatctgattcagctattagaagatgat
gcccagaggaacttcagtgtttggatgagatggggccgagttgggaaaatgggacagcac
agcctggtggcttgttcaggcaatctcaacaaggccaaggaaatctttcagaagaaattc
cttgacaaaacgaaaaacaattgggaagatcgagaaaagtttgagaaggtgcctggaaaa
tatgatatgctacagatggactatgccaccaatactcaggatgaagaggaaacaaagaaa
gaggaatctcttaaatctcccttgaagccagagtcacagctagatcttcgggtacaggag
ttaataaagttgatctgtaatgttcaggccatggaagaaatgatgatggaaatgaagtat
aataccaagaaagccccacttgggaagctgacagtggcacaaatcaaggcaggttaccag
tctcttaagaagattgaggattgtattcgggctggccagcatggacgagctctcatggaa
gcatgcaatgaattctacaccaggattccgcatgactttggactccgtactcctccacta
atccggacacagaaggaactgtcagaaaaaatacaattactagaggctttgggagacatt
gaaattgctattaagctggtgaaaacagagctacaaagcccagaacacccattggaccaa
cactatagaaacctacattgtgccttgcgcccccttgaccatgaaagttatgagttcaaa
gtgatttcccagtacctacaatctacccatgctcccacacacagcgactataccatgacc
ttgctggatttgtttgaagtggagaaggatggtgagaaagaagccttcagagaggacctt
cataacaggatgcttctatggcatggttccaggatgagtaactgggtgggaatcttgagc
catgggcttcgaattgccccacctgaagctcccatcacaggttacatgtttgggaaagga
atctactttgctgacatgtcttccaagagtgccaattactgctttgcctctcgcctaaag
aatacaggactgctgctcttatcagaggtagctctaggtcagtgtaatgaactactagag
gccaatcctaaggccgaaggattgcttcaaggtaaacatagcaccaaggggctgggcaag
atggctcccagttctgcccacttcgtcaccctgaatgggagtacagtgccattaggacca
gcaagtgacacaggaattctgaatccagatggttataccctcaactacaatgaatatatt
gtatataaccccaaccaggtccgtatgcggtaccttttaaaggttcagtttaatttcctt
cagctgtggtga

KEGG   Homo sapiens (human): 10039
Entry
10039             CDS       T01001                                 

Gene name
PARP3, ADPRT3, ADPRTL2, ADPRTL3, ARTD3, IRT1, PADPRT-3
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 3
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04210  Apoptosis
Drug target
Pamiparib: D11426
Rucaparib (DG01864): D10079 D10157 D10982<US>
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    10039 (PARP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    10039 (PARP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10039 (PARP3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10039 (PARP3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10039 (PARP3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     10039 (PARP3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     10039 (PARP3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    10039 (PARP3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     10039 (PARP3)
SSDB
Motif
Pfam: PARP PARP_reg WGR RIG-I_C
Other DBs
NCBI-GeneID: 10039
NCBI-ProteinID: NP_001003931
OMIM: 607726
HGNC: 273
Ensembl: ENSG00000041880
Vega: OTTHUMG00000156931
Pharos: Q9Y6F1(Tclin)
UniProt: Q9Y6F1 A0A024R318
LinkDB
Structure
PDB: 

Position
3p21.2
AA seq 533 aa
MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGT
QVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLED
AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRV
QPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
KGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWK
VNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT
QDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggctccaaagccgaagccctgggtacagactgagggccctgagaagaagaagggccgg
caggcaggaagggaggaggaccccttccgctccaccgctgaggccctcaaggccataccc
gcagagaagcgcataatccgcgtggatccaacatgtccactcagcagcaaccccgggacc
caggtgtatgaggactacaactgcaccctgaaccagaccaacatcgagaacaacaacaac
aagttctacatcatccagctgctccaagacagcaaccgcttcttcacctgctggaaccgc
tggggccgtgtgggagaggtcggccagtcaaagatcaaccacttcacaaggctagaagat
gcaaagaaggactttgagaagaaatttcgggaaaagaccaagaacaactgggcagagcgg
gaccactttgtgtctcacccgggcaagtacacacttatcgaagtacaggcagaggatgag
gcccaggaagctgtggtgaaggtggacagaggcccagtgaggactgtgactaagcgggtg
cagccctgctccctggacccagccacgcagaagctcatcactaacatcttcagcaaggag
atgttcaagaacaccatggccctcatggacctggatgtgaagaagatgcccctgggaaag
ctgagcaagcaacagattgcacggggtttcgaggccttggaggcgctggaggaggccctg
aaaggccccacggatggtggccaaagcctggaggagctgtcctcacacttttacaccgtc
atcccgcacaacttcggccacagccagcccccgcccatcaattcccctgagcttctgcag
gccaagaaggacatgctgctggtgctggcggacatcgagctggcccaggccctgcaggca
gtctctgagcaggagaagacggtggaggaggtgccacaccccctggaccgagactaccag
cttctcaagtgccagctgcagctgctagactctggagcacctgagtacaaggtgatacag
acctacttagaacagactggcagcaaccacaggtgccctacacttcaacacatctggaaa
gtaaaccaagaaggggaggaagacagattccaggcccactccaaactgggtaatcggaag
ctgctgtggcatggcaccaacatggccgtggtggccgccatcctcactagtgggctccgc
atcatgccacattctggtgggcgtgttggcaagggcatctactttgcctcagagaacagc
aagtcagctggatatgttattggcatgaagtgtggggcccaccatgtcggctacatgttc
ctgggtgaggtggccctgggcagagagcaccatatcaacacggacaaccccagcttgaag
agcccacctcctggcttcgacagtgtcattgcccgaggccacaccgagcctgatccgacc
caggacactgagttggagctggatggccagcaagtggtggtgccccagggccagcctgtg
ccctgcccagagttcagcagctccacattctcccagagcgagtacctcatctaccaggag
agccagtgtcgcctgcgctacctgctggaggtccacctctga

KEGG   Homo sapiens (human): 142
Entry
142               CDS       T01001                                 

Gene name
PARP1, ADPRT, ADPRT_1, ADPRT1, ARTD1, PARP, PARP-1, PPOL, pADPRT-1
Definition
(RefSeq) poly(ADP-ribose) polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
Drug target
Iniparib: D09913
Niraparib (DG03120): D10140 D11895<JP/US>
Olaparib: D09730<JP/US>
Pamiparib: D11426
Rucaparib (DG01864): D10079 D10157 D10982<US>
Talazoparib (DG01865): D10732 D10733<US>
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    142 (PARP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    142 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    142 (PARP1)
   04217 Necroptosis
    142 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    142 (PARP1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    142 (PARP1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    142 (PARP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     142 (PARP1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     142 (PARP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    142 (PARP1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     142 (PARP1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2 ESF1
Other DBs
NCBI-GeneID: 142
NCBI-ProteinID: NP_001609
OMIM: 173870
HGNC: 270
Ensembl: ENSG00000143799
Vega: OTTHUMG00000037556
Pharos: P09874(Tclin)
UniProt: P09874 A0A024R3T8
LinkDB
Structure
PDB: 

Position
1q42.12
AA seq 1014 aa
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggagtcttcggataagctctatcgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcgcccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcaccctgacgttgaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggat
ggaattggtagcaaggcagagaagactctgggtgactttgcagcagagtatgccaagtcc
aacagaagtacgtgcaaggggtgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatggtggacccggagaagccacagctaggcatgattgaccgctggtaccatcca
ggctgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctacagaggataaagaagccctgaagaagcagctccca
ggagtcaagagtgaaggaaagagaaaaggcgatgaggtggatggagtggatgaagtggcg
aagaagaaatctaaaaaagaaaaagacaaggatagtaagcttgaaaaagccctaaaggct
cagaacgacctgatctggaacatcaaggacgagctaaagaaagtgtgttcaactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagctgatggcatggtgttcggtgccctccttccctgcgaggaatgctcgggt
cagctggtcttcaagagcgatgcctattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaaacaggaccgtatattccccccagaa
accagcgcctccgtggcggccacgcctccgccctccacagcctcggctcctgctgctgtg
aactcctctgcttcagcagataagccattatccaacatgaagatcctgactctcgggaag
ctgtcccggaacaaggatgaagtgaaggccatgattgagaaactcggggggaagttgacg
gggacggccaacaaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacgtctccgcctccaccaagagccttcaggagttgttcttagcgcacatcttgtcccct
tggggggcagaggtgaaggcagagcctgttgaagttgtggccccaagagggaagtcaggg
gctgcgctctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtcttcagtgccacccttggcctggtg
gacatcgttaaaggaaccaactcctactacaagctgcagcttctggaggacgacaaggaa
aacaggtattggatattcaggtcctggggccgtgtgggtacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacgaagtatcccaaaaagttctacccc
ctggagattgactatggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagatgatctttgatgtggaa
agtatgaagaaagccatggtggagtatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcatactccatcctcagtgaggtccagcaggcggtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccacgactttgggatgaagaagcctccgctcctgaacaatgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggatcccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttgacagagattctgaagaagccgagatcatcaggaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagag
cgtgaaggcgaatgccagcgttacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgctgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcgcccgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcctg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaactacccctgatccttcagct
aacattagtctggatggtgtagacgttcctcttgggaccgggatttcatctggtgtgaat
gacacctctctactatataacgagtacattgtctatgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

KEGG   Homo sapiens (human): 143
Entry
143               CDS       T01001                                 

Gene name
PARP4, ADPRTL1, ARTD4, PARP-4, PARPL, PH5P, VAULT3, VPARP, VWA5C, p193
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 4
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04210  Apoptosis
Drug target
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    143 (PARP4)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    143 (PARP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    143 (PARP4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    143 (PARP4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    143 (PARP4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     143 (PARP4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     143 (PARP4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    143 (PARP4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     143 (PARP4)
SSDB
Motif
Pfam: VIT PARP VIT_2 VWA VWA_3 BRCT BRCT_2 VWA_2 PARP_reg PTCB-BRCT LIG3_BRCT
Other DBs
NCBI-GeneID: 143
NCBI-ProteinID: NP_006428
OMIM: 607519
HGNC: 271
Ensembl: ENSG00000102699
Vega: OTTHUMG00000016582
Pharos: Q9UKK3(Tchem)
UniProt: Q9UKK3
LinkDB
Position
13q12.12
AA seq 1724 aa
MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQ
LNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCP
DSATEEEDTVELTEFGMQNVEIPHLPQDFEVAKYNTLEKVGMEGGQEAVVVELQCSRDSR
DCPFLISSHFLLDDGMETRRQFAIKKTSEDASEYFENYIEELKKQGFLLREHFTPEATQL
ASEQLQALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGI
LLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVC
ETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRVGRV
NETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDVGNLGSGIYFSD
SLSTSIKYSHPGETDGTRLLLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVT
TDFEDDEFVVYKTNQVKMKYIIKFSMPGDQIKDFHPSDHTELEEYRPEFSNFSKVEDYQL
PDAKTSSSTKAGLQDASGNLVPLEDVHIKGRIIDTVAQVIVFQTYTNKSHVPIEAKYIFP
LDDKAAVCGFEAFINGKHIVGEIKEKEEAQQEYLEAVTQGHGAYLMSQDAPDVFTVSVGN
LPPKAKVLIKITYITELSILGTVGVFFMPATVAPWQQDKALNENLQDTVEKICIKEIGTK
QSFSLTMSIEMPYVIEFIFSDTHELKQKRTDCKAVISTMEGSSLDSSGFSLHIGLSAAYL
PRMWVEKHPEKESEACMLVFQPDLDVDLPDLASESEVIICLDCSSSMEGVTFLQAKQIAL
HALSLVGEKQKVNIIQFGTGYKELFSYPKHITSNTMAAEFIMSATPTMGNTDFWKTLRYL
SLLYPARGSRNILLVSDGHLQDESLTLQLVKRSRPHTRLFACGIGSTANRHVLRILSQCG
AGVFEYFNAKSKHSWRKQIEDQMTRLCSPSCHSVSVKWQQLNPDVPEALQAPAQVPSLFL
NDRLLVYGFIPHCTQATLCALIQEKEFRTMVSTTELQKTTGTMIHKLAARALIRDYEDGI
LHENETSHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPDIPKVSELIAK
EDVDFLPYMSWQGEPQEAVRNQSLLASSEWPELRLSKRKHRKIPFSKRKMELSQPEVSED
FEEDGLGVLPAFTSNLERGGVEKLLDLSWTESCKPTATEPLFKKVSPWETSTSSFFPILA
PAVGSYLPPTARAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPGTCADWIPQS
ASCPTGPPQNPPSSPYCGIVFSGSSLSSAQSAPLQHPGGFTTRPSAGTFPELDSPQLHFS
LPTDPDPIRGFGSYHPSASSPFHFQPSAASLTANLRLPMASALPEALCSQSRTTPVDLCL
LEESVGSLEGSRCPVFAFQSSDTESDELSEVLQDSCFLQIKCDTKDDSILCFLEVKEEDE
IVCIQHWQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQKGIQSLGVKGR
ECLLDLIATMLVLQFIRTRLEKEGIVFKSLMKMDDASISRNIPWAFEAIKQASEWVRRTE
GQYPSICPRLELGNDWDSATKQLLGLQPISTVSPLHRVLHYSQG
NT seq 5175 nt   +upstreamnt  +downstreamnt
atggtgatgggaatctttgcaaattgtatcttctgtttgaaagtgaagtacttacctcag
cagcagaagaaaaagctacaaactgacattaaggaaaatggcggaaagttttccttttcg
ttaaatcctcagtgcacacatataatcttagataatgctgatgttctgagtcagtaccaa
ctgaattctatccaaaagaaccacgttcatattgcaaacccagattttatatggaaatct
atcagggaaaagagactcttggatgtaaagaattatgatccttataagcccctggacatc
acaccacctcctgatcagaaggcgagcagttctgaagtgaaaacagaaggtctatgcccg
gacagtgccacagaggaggaagacactgtggaactcactgagtttggtatgcagaatgtt
gaaattcctcatcttcctcaagattttgaagttgcaaaatataacaccttggagaaagtg
ggaatggagggaggccaggaagctgtggtggtggagcttcagtgttcgcgggactccagg
gactgtcctttcctgatatcctcacacttcctcctggatgatggcatggagactagaaga
cagtttgctataaagaaaacctctgaagatgcaagtgaatactttgaaaattacattgaa
gaactgaagaaacaaggatttctactaagagaacatttcacacctgaagcaacccaatta
gcatctgaacaattgcaagcattgcttttggaggaagtcatgaattcaagcactctgagc
caagaggtgagcgatttagtagagatgatttgggcagaggccctgggccacctggaacac
atgcttctcaagccagtgaacaggattagcctcaacgatgtgagcaaggcagaggggatt
ctccttctagtaaaggcagcactgaaaaatggagaaacagcagagcaattgcaaaagatg
atgacagagttttacagactgatacctcacaaaggcacaatgcccaaagaagtgaacctg
ggactattggctaagaaagcagacctctgccagctaataagagacatggttaatgtctgt
gaaactaatttgtccaaacccaacccaccatccctggccaaataccgagctttgaggtgc
aaaattgagcatgttgaacagaatactgaagaatttctcagggttagaaaagaggttttg
cagaatcatcacagtaagagcccagtggatgtcttgcagatatttagagttggcagagtg
aatgaaaccacagagtttttgagcaaacttggtaatgtgaggcccttgttgcatggttct
cctgtacaaaacatcgtgggaatcttgtgtcgagggttgcttttacccaaagtagtggaa
gatcgtggtgtgcaaagaacagacgtcggaaaccttggaagtgggatttatttcagtgat
tcgctcagtacaagtatcaagtactcacacccgggagagacagatggcaccagactcctg
ctcatttgtgacgtagccctcggaaagtgtatggacttacatgagaaggacttttcctta
actgaagcaccaccaggctacgacagtgtgcatggagtttcgcaaacagcctctgtcacc
acagactttgaggatgatgaatttgttgtctataaaaccaatcaggttaaaatgaaatat
attattaaattttccatgcctggagatcagataaaggactttcatcctagtgatcatact
gaattagaggaatacagacctgagttttcaaatttttcaaaggttgaagattaccagtta
ccagatgccaaaacttccagcagcaccaaggccggcctccaggatgcctctgggaacttg
gttcctctggaggatgtccacatcaaagggagaatcatagacactgtagcccaggtcatt
gtttttcagacatacacaaataaaagtcacgtgcccattgaggcaaaatatatctttcct
ttggatgacaaggccgctgtgtgtggcttcgaagccttcatcaatgggaagcacatagtt
ggagagattaaagagaaggaagaagcccagcaagagtacctagaagccgtgacccagggc
catggcgcttacctgatgagtcaggatgctccggacgtttttactgtaagtgttggaaac
ttaccccctaaggctaaggttcttataaaaattacctacatcacagaactcagcatcctg
ggcactgttggtgtctttttcatgcccgccaccgtagcaccctggcaacaggacaaggct
ttgaatgaaaaccttcaggatacagtagagaagatttgtataaaagaaataggaacaaag
caaagcttctctttgactatgtctattgagatgccgtatgtgattgaattcattttcagt
gatacacatgaactgaaacaaaagcgcacagactgcaaagctgtcattagcaccatggaa
ggcagctccttagacagcagtggattttctctccacatcggtttgtctgctgcctatctc
ccaagaatgtgggttgaaaaacatccagaaaaagaaagcgaggcttgcatgcttgtcttt
caacccgatctcgatgtcgacctccctgacctagccagtgagagcgaagtgattatttgt
cttgactgctccagttccatggagggtgtgacattcttgcaagccaagcaaatcgccttg
catgcgctgtccttggtgggtgagaagcagaaagtaaatattatccagttcggcacaggt
tacaaggagctattttcgtatcctaagcatatcacaagcaataccatggcagcagagttc
atcatgtctgccacacctaccatggggaacacagacttctggaaaacactccgatatctt
agcttattgtaccctgctcgagggtcacggaacatcctcctggtgtctgatgggcacctc
caggatgagagcctgacattacagctcgtgaagaggagccgcccgcacaccaggttattc
gcctgcggtatcggttctacagcaaatcgtcacgtcttaaggattttgtcccagtgtggt
gccggagtatttgaatattttaatgcaaaatccaagcatagttggagaaaacagatagaa
gaccaaatgaccaggctatgttctccgagttgccactctgtctccgtcaaatggcagcaa
ctcaatccagatgtgcccgaggccctgcaggccccagcccaggtgccgtccttgtttctc
aatgatcgactccttgtctatggattcattcctcactgcacacaggcaactctgtgtgca
ctaattcaagagaaagaatttcgtacaatggtgtcgactactgagcttcagaagacaact
ggaactatgatccacaagctggcagcccgagctctaatcagagattatgaagatggcatt
cttcacgaaaatgaaaccagtcatgagatgaaaaaacaaaccttgaaatctctgattatt
aaactcagtaaagaaaactctctcataacacaatttacaagctttgtggcagttgagaaa
agggatgagaatgagtcgccttttcctgatattccaaaagtttctgaacttattgccaaa
gaagatgtagacttcctgccctacatgagctggcagggggagccccaagaagccgtcagg
aaccagtctcttttagcatcctctgagtggccagaattacgtttatccaaacgaaaacat
aggaaaattccattttccaaaagaaaaatggaattatctcagccagaagtttctgaagat
tttgaagaggatggcttaggtgtactaccagctttcacatcaaatttggaacgtggaggt
gtggaaaagctattggatttaagttggacagagtcatgtaaaccaacagcaactgaacca
ctatttaagaaagtcagtccatgggaaacatctacttctagcttttttcctattttggct
ccggccgttggttcctatcttcccccgactgcccgcgctcacagtcctgcttccttgtct
tttgcctcatatcgtcaggtagctagtttcggttcagctgctcctcccagacagtttgat
gcatctcaattcagccaaggccctgtgcctggcacttgtgctgactggatcccacagtcg
gcgtcttgtcccacaggacctccccagaacccaccttcttcaccctattgtggcattgtt
ttttcagggagctcattaagctctgcacagtctgctccactgcaacatcctggaggcttt
actaccaggccttctgctggcaccttccctgagctggattctccccagcttcatttctct
cttcctacagaccctgatcccatcagaggttttgggtcttatcatccctctgcttcctct
ccttttcattttcaaccttccgcagcctctttgactgccaaccttaggctgccaatggcc
tctgctttacctgaggctctttgcagtcagtcccggactaccccagtagatctctgtctt
ctagaagaatcagtaggcagtctcgaaggaagtcgatgtcctgtctttgcttttcaaagt
tctgacacagaaagtgatgagctatcagaagtacttcaagacagctgctttttacaaata
aaatgtgatacaaaagatgacagtatcctgtgctttctggaagtaaaagaagaggatgaa
atagtgtgcatacaacactggcaggatgctgtgccttggacagaactcctcagtctacag
acagaggatggcttctggaaacttacaccagaactgggacttatattaaatcttaataca
aatggtttgcacagctttcttaaacaaaaaggcattcaatctctaggtgtaaaaggaaga
gaatgtctcctggacctaattgccacaatgctggtactacagtttattcgcaccaggttg
gaaaaagagggaatagtgttcaaatcactgatgaaaatggatgacgcttctatttccagg
aatattccctgggcttttgaggcaataaagcaagcaagtgaatgggtaagaagaactgaa
ggacagtacccatctatctgcccacggcttgaactggggaacgactgggactctgccacc
aagcagttgctgggactccagcccataagcactgtgtcccctcttcatagagtcctccat
tacagtcaaggctaa

DBGET integrated database retrieval system