KEGG   Homo sapiens (human): 1027Help
Entry
1027              CDS       T01001                                 

Gene name
CDKN1B, CDKN4, KIP1, MEN1B, MEN4, P27KIP1
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00119  MLL-AF4 fusion to transcriptional activation
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00290  Mutation-inactivated MEN1 to transcription
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00317  Aryl hydrocarbon receptor signaling pathway
N00359  HPV E7 to p27-cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
Disease
H00018  Gastric cancer
H00024  Prostate cancer
H00247  Multiple endocrine neoplasia syndrome
H01102  Pituitary adenomas
H01431  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    1027 (CDKN1B)
   04066 HIF-1 signaling pathway
    1027 (CDKN1B)
   04068 FoxO signaling pathway
    1027 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    1027 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1027 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1027 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    1027 (CDKN1B)
   05206 MicroRNAs in cancer
    1027 (CDKN1B)
   05203 Viral carcinogenesis
    1027 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    1027 (CDKN1B)
   05220 Chronic myeloid leukemia
    1027 (CDKN1B)
   05215 Prostate cancer
    1027 (CDKN1B)
   05222 Small cell lung cancer
    1027 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1027 (CDKN1B)
   04934 Cushing syndrome
    1027 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    1027 (CDKN1B)
   05169 Epstein-Barr virus infection
    1027 (CDKN1B)
   05165 Human papillomavirus infection
    1027 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1027 (CDKN1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI Multi-haem_cyto
Motif
Other DBs
NCBI-GeneID: 1027
NCBI-ProteinID: NP_004055
OMIM: 600778
HGNC: 1785
Ensembl: ENSG00000111276
Vega: OTTHUMG00000149914
Pharos: P46527(Tbio)
UniProt: P46527 Q6I9V6
LinkDB All DBs
Structure
PDB: 

Position
12p13.1
AA seq 198 aa AA seqDB search
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system