KEGG   Homo sapiens (human): 10718
Entry
10718             CDS       T01001                                 

Gene name
NRG3, HRG3, pro-NRG3
Definition
(RefSeq) neuregulin 3
  KO
K05457  neuregulin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Network
nt06415  PI3K signaling
nt06464  Amyotrophic lateral sclerosis
  Element
N01163  NRG-ERBB4-PI3K signaling pathway
N01164  Mutation-inactivated ERBB4 to NRG-ERBB4-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    10718 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10718 (NRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10718 (NRG3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   10718 (NRG3)
SSDB
Motif
Pfam: EGF Laminin_EGF LapA_dom EGF_2
Other DBs
NCBI-GeneID: 10718
NCBI-ProteinID: NP_001010848
OMIM: 605533
HGNC: 7999
Ensembl: ENSG00000185737
Vega: OTTHUMG00000018626
Pharos: P56975(Tbio)
UniProt: P56975 B9EGV5
LinkDB
Position
10q23.1
AA seq 696 aa
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPATVPSTTAPFFSSSTLGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQ
VLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPG
QRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGYSSSGLKTQRNT
SINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQMPGISEVKSIKW
CKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDS
ASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggtgccgcttcggcagccgccgcctcg
gccgaggagggcaccgcggcggctgcggcggcggcagcggcgggcgggggcccggacggc
ggcggcgaaggggcggccgagcccccccgggagttacgctgtagcgactgcatcgtgtgg
aaccggcagcagacgtggctgtgcgtggtacctctgttcatcggcttcatcggcctgggg
ctcagcctcatgcttctcaaatggatcgtggtgggctccgtcaaggagtacgtgcccacc
gacctagtggactccaaggggatgggccaggaccccttcttcctctccaagcccagctct
ttccccaaggccatggagaccaccaccactaccacttccaccacgtcccccgccaccccc
tccgccgggggtgccgcctcctccaggacgcccaaccggattagcactcgcctgaccacc
atcacgcgggcgcccactcgcttccccgggcaccgggtgcccatccgggccagcccgcgc
tccaccacagcacggaacactgcggcccctgcgacggtcccgtccaccacggccccgttc
ttcagtagcagcacgctgggctcccgacccccggtgccaggaactccaagtacccaggca
atgccctcctggcctactgcggcatacgctacctcctcctaccttcacgattctactccc
tcctggaccctgtctccctttcaggatgctgcctcctcttcttcctcttcttcctcctcc
gctaccaccaccacaccagaaactagcaccagccccaaatttcatacgacgacatattcc
acagagcgatccgagcacttcaaaccctgccgagacaaggaccttgcatactgtctcaat
gatggcgagtgctttgtgatcgaaaccctgaccggatcccataaacactgtcggtgcaaa
gaaggctaccaaggagtccgttgtgatcaatttctgccgaaaactgattccatcttatcg
gatccaacagaccacttggggattgaattcatggagagtgaagaagtttatcaaaggcag
gtgctgtcaatttcatgtatcatctttggaattgtcatcgtgggcatgttctgtgcagca
ttctacttcaaaagcaagaaacaagctaaacaaatccaagagcagctgaaagtgccacaa
aatggtaaaagctacagtctcaaagcatccagcacaatggcaaagtcagagaacttggtg
aagagccatgtccagctgcaaaattattcaaaggtggaaaggcatcctgtgactgcattg
gagaaaatgatggagtcaagttttgtcggcccccagtcattccctgaggtcccttctcct
gacagaggaagccagtctgtcaaacaccacaggagtctatcctcttgctgcagcccaggg
caaagaagtggcatgctccataggaatgccttcagaaggacacccccgtcaccccgaagt
aggctaggtggaattgtgggaccagcatatcagcaactcgaagaatcaaggatcccagac
caggatacgataccttgccaagggtattcatccagtggtttaaaaacccaacgaaataca
tcaataaatatgcaactgccttcaagagagacaaacccctattttaatagcttggagcaa
aaggacctggtgggctattcatccacaagggccagttctgtgcccatcatcccttcagtg
ggtttagaggaaacctgcctgcaaatgccagggatttctgaagtcaaaagcatcaaatgg
tgcaaaaactcctattcagctgacgttgtcaatgtgagtattccagtcagcgattgtctt
atagcagaacaacaagaagtgaaaatattgctagaaactgtccaggagcagatccgaatt
ctgactgatgccagacggtcagaagactacgaactggccagcgtagaaaccgaggacagt
gcaagcgaaaacacagcctttctccccctgagtcccacagccaaatcagaacgagaggcg
caatttgtcttaagaaatgaaatacaaagagactctgcattgaccaagtga

DBGET integrated database retrieval system