KEGG   Homo sapiens (human): 1232Help
Entry
1232              CDS       T01001                                 

Gene name
CCR3, C_C_CKR3, CC-CKR-3, CD193, CKR_3, CKR3, CMKBR3
Definition
(RefSeq) C-C motif chemokine receptor 3
  KO
K04178  C-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1232 (CCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1232 (CCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1232 (CCR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1232 (CCR3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    1232 (CCR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1232 (CCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1232 (CCR3)
   04050 Cytokine receptors [BR:hsa04050]
    1232 (CCR3)
   04090 CD molecules [BR:hsa04090]
    1232 (CCR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1232 (CCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1232 (CCR3)
CD molecules [BR:hsa04090]
 Proteins
  1232 (CCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3112
Motif
Other DBs
NCBI-GeneID: 1232
NCBI-ProteinID: NP_001828
OMIM: 601268
HGNC: 1604
Ensembl: ENSG00000183625
Vega: OTTHUMG00000133484
Pharos: P51677(Tchem)
UniProt: P51677 Q8TDP5 A1LPE5
LinkDB All DBs
Position
3p21.31
AA seq 355 aa AA seqDB search
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcactagatacagttgagacctttggtaccacatcctactatgatgacgtg
ggcctgctctgtgaaaaagctgataccagagcactgatggcccagtttgtgcccccgctg
tactccctggtgttcactgtgggcctcttgggcaatgtggtggtggtgatgatcctcata
aaatacaggaggctccgaattatgaccaacatctacctgctcaacctggccatttcggac
ctgctcttcctcgtcacccttccattctggatccactatgtcagggggcataactgggtt
tttggccatggcatgtgtaagctcctctcagggttttatcacacaggcttgtacagcgag
atctttttcataatcctgctgacaatcgacaggtacctggccattgtccatgctgtgttt
gcccttcgagcccggactgtcacttttggtgtcatcaccagcatcgtcacctggggcctg
gcagtgctagcagctcttcctgaatttatcttctatgagactgaagagttgtttgaagag
actctttgcagtgctctttacccagaggatacagtatatagctggaggcatttccacact
ctgagaatgaccatcttctgtctcgttctccctctgctcgttatggccatctgctacaca
ggaatcatcaaaacgctgctgaggtgccccagtaaaaaaaagtacaaggccatccggctc
atttttgtcatcatggcggtgtttttcattttctggacaccctacaatgtggctatcctt
ctctcttcctatcaatccatcttatttggaaatgactgtgagcggagcaagcatctggac
ctggtcatgctggtgacagaggtgatcgcctactcccactgctgcatgaacccggtgatc
tacgcctttgttggagagaggttccggaagtacctgcgccacttcttccacaggcacttg
ctcatgcacctgggcagatacatcccattccttcctagtgagaagctggaaagaaccagc
tctgtctctccatccacagcagagccggaactctctattgtgttttag

KEGG   Homo sapiens (human): 1233Help
Entry
1233              CDS       T01001                                 

Gene name
CCR4, CC-CKR-4, CD194, CKR4, CMKBR4, ChemR13, HGCN:14099, K5-5
Definition
(RefSeq) C-C motif chemokine receptor 4
  KO
K04179  C-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
Drug target
Mogamulizumab: D09761
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1233 (CCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1233 (CCR4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1233 (CCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1233 (CCR4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    1233 (CCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1233 (CCR4)
   04050 Cytokine receptors [BR:hsa04050]
    1233 (CCR4)
   04090 CD molecules [BR:hsa04090]
    1233 (CCR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1233 (CCR4)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1233 (CCR4)
CD molecules [BR:hsa04090]
 Proteins
  1233 (CCR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 1233
NCBI-ProteinID: NP_005499
OMIM: 604836
HGNC: 1605
Ensembl: ENSG00000183813
Vega: OTTHUMG00000130752
Pharos: P51679(Tclin)
UniProt: P51679 A0N0Q1 A0A024R2J7
LinkDB All DBs
Position
3p22.3
AA seq 360 aa AA seqDB search
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccacggatatagcagacaccaccctcgatgaaagcatatacagcaattactat
ctgtatgaaagtatccccaagccttgcaccaaagaaggcatcaaggcatttggggagctc
ttcctgcccccactgtattccttggtttttgtatttggtctgcttggaaattctgtggtg
gttctggtcctgttcaaatacaagcggctcaggtccatgactgatgtgtacctgctcaac
cttgccatctcggatctgctcttcgtgttttccctccctttttggggctactatgcagca
gaccagtgggtttttgggctaggtctgtgcaagatgatttcctggatgtacttggtgggc
ttttacagtggcatattctttgtcatgctcatgagcattgatagatacctggcaattgtg
cacgcggtgttttccttgagggcaaggaccttgacttatggggtcatcaccagtttggct
acatggtcagtggctgtgttcgcctcccttcctggctttctgttcagcacttgttatact
gagcgcaaccatacctactgcaaaaccaagtactctctcaactccacgacgtggaaggtt
ctcagctccctggaaatcaacattctcggattggtgatccccttagggatcatgctgttt
tgctactccatgatcatcaggaccttgcagcattgtaaaaatgagaagaagaacaaggcg
gtgaagatgatctttgccgtggtggtcctcttccttgggttctggacaccttacaacata
gtgctcttcctagagaccctggtggagctagaagtccttcaggactgcacctttgaaaga
tacttggactatgccatccaggccacagaaactctggcttttgttcactgctgccttaat
cccatcatctacttttttctgggggagaaatttcgcaagtacatcctacagctcttcaaa
acctgcaggggcctttttgtgctctgccaatactgtgggctcctccaaatttactctgct
gacacccccagctcatcttacacgcagtccaccatggatcatgatctccatgatgctctg
tag

KEGG   Homo sapiens (human): 1237Help
Entry
1237              CDS       T01001                                 

Gene name
CCR8, CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1
Definition
(RefSeq) C-C motif chemokine receptor 8
  KO
K04183  C-C chemokine receptor type 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1237 (CCR8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1237 (CCR8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1237 (CCR8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1237 (CCR8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    1237 (CCR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1237 (CCR8)
   04050 Cytokine receptors [BR:hsa04050]
    1237 (CCR8)
   04090 CD molecules [BR:hsa04090]
    1237 (CCR8)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1237 (CCR8)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1237 (CCR8)
CD molecules [BR:hsa04090]
 Proteins
  1237 (CCR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 1237
NCBI-ProteinID: NP_005192
OMIM: 601834
HGNC: 1609
Ensembl: ENSG00000179934
Vega: OTTHUMG00000131290
Pharos: P51685(Tchem)
UniProt: P51685
LinkDB All DBs
Position
3p22.1
AA seq 355 aa AA seqDB search
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS
MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV
LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV
LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY
AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggattatacacttgacctcagtgtgacaacagtgaccgactactactaccctgatatc
ttctcaagcccctgtgatgcggaacttattcagacaaatggcaagttgctccttgctgtc
ttttattgcctcctgtttgtattcagtcttctgggaaacagcctggtcatcctggtcctt
gtggtctgcaagaagctgaggagcatcacagatgtatacctcttgaacctggccctgtct
gacctgctttttgtcttctccttcccctttcagacctactatctgctggaccagtgggtg
tttgggactgtaatgtgcaaagtggtgtctggcttttattacattggcttctacagcagc
atgtttttcatcaccctcatgagtgtggacaggtacctggctgttgtccatgccgtgtat
gccctaaaggtgaggacgatcaggatgggcacaacgctgtgcctggcagtatggctaacc
gccattatggctaccatcccattgctagtgttttaccaagtggcctctgaagatggtgtt
ctacagtgttattcattttacaatcaacagactttgaagtggaagatcttcaccaacttc
aaaatgaacattttaggcttgttgatcccattcaccatctttatgttctgctacattaaa
atcctgcaccagctgaagaggtgtcaaaaccacaacaagaccaaggccatcaggttggtg
ctcattgtggtcattgcatctttacttttctgggtcccattcaacgtggttcttttcctc
acttccttgcacagtatgcacatcttggatggatgtagcataagccaacagctgacttat
gccacccatgtcacagaaatcatttcctttactcactgctgtgtgaaccctgttatctat
gcttttgttggggagaagttcaagaaacacctctcagaaatatttcagaaaagttgcagc
caaatcttcaactacctaggaagacaaatgcctagggagagctgtgaaaagtcatcatcc
tgccagcagcactcctcccgttcctccagcgtagactacattttgtga

KEGG   Homo sapiens (human): 3579Help
Entry
3579              CDS       T01001                                 

Gene name
CXCR2, CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB
Definition
(RefSeq) C-X-C motif chemokine receptor 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00427  HCMV vCXCL to CXCR-GNB/G-PI3K-AKT signaling pathway
Drug target
Danirixin: D10387
Elubrixin (DG01371): D10332 D10420
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    3579 (CXCR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3579 (CXCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3579 (CXCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3579 (CXCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    3579 (CXCR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3579 (CXCR2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    3579 (CXCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3579 (CXCR2)
   04050 Cytokine receptors [BR:hsa04050]
    3579 (CXCR2)
   04090 CD molecules [BR:hsa04090]
    3579 (CXCR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    3579 (CXCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3579 (CXCR2)
CD molecules [BR:hsa04090]
 Proteins
  3579 (CXCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 3579
NCBI-ProteinID: NP_001161770
OMIM: 146928
HGNC: 6027
Ensembl: ENSG00000180871
Vega: OTTHUMG00000133107
Pharos: P25025(Tchem)
UniProt: P25025 Q53PC4
LinkDB All DBs
Position
2q35
AA seq 360 aa AA seqDB search
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaagattttaacatggagagtgacagctttgaagatttctggaaaggtgaagatctt
agtaattacagttacagctctaccctgcccccttttctactagatgccgccccatgtgaa
ccagaatccctggaaatcaacaagtattttgtggtcattatctatgccctggtattcctg
ctgagcctgctgggaaactccctcgtgatgctggtcatcttatacagcagggtcggccgc
tccgtcactgatgtctacctgctgaacctagccttggccgacctactctttgccctgacc
ttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaag
gtggtctcactcctgaaggaagtcaacttctatagtggcatcctgctactggcctgcatc
agtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgctac
ttggtcaaattcatatgtctcagcatctggggtctgtccttgctcctggccctgcctgtc
ttacttttccgaaggaccgtctactcatccaatgttagcccagcctgctatgaggacatg
ggcaacaatacagcaaactggcggatgctgttacggatcctgccccagtcctttggcttc
atcgtgccactgctgatcatgctgttctgctacggattcaccctgcgtacgctgtttaag
gcccacatggggcagaagcaccgggccatgcgggtcatctttgctgtcgtcctcatcttc
ctgctctgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccag
gtgatccaggagacctgtgagcgccgcaatcacatcgaccgggctctggatgccaccgag
attctgggcatccttcacagctgcctcaaccccctcatctacgccttcattggccagaag
tttcgccatggactcctcaagattctagctatacatggcttgatcagcaaggactccctg
cccaaagacagcaggccttcctttgttggctcttcttcagggcacacttccactactctc
taa

DBGET integrated database retrieval system