KEGG   Homo sapiens (human): 3105Help
Entry
3105              CDS       T01001                                 

Gene name
HLA-A, HLAA
Definition
(RefSeq) major histocompatibility complex, class I, A
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3105 (HLA-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3105 (HLA-A)
   04145 Phagosome
    3105 (HLA-A)
  09143 Cell growth and death
   04218 Cellular senescence
    3105 (HLA-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3105 (HLA-A)
   04612 Antigen processing and presentation
    3105 (HLA-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3105 (HLA-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3105 (HLA-A)
   05330 Allograft rejection
    3105 (HLA-A)
   05332 Graft-versus-host disease
    3105 (HLA-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3105 (HLA-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3105 (HLA-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3105 (HLA-A)
   05170 Human immunodeficiency virus 1 infection
    3105 (HLA-A)
   05168 Herpes simplex virus 1 infection
    3105 (HLA-A)
   05163 Human cytomegalovirus infection
    3105 (HLA-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3105 (HLA-A)
   05169 Epstein-Barr virus infection
    3105 (HLA-A)
   05165 Human papillomavirus infection
    3105 (HLA-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3105 (HLA-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3105 (HLA-A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3105 (HLA-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3105 (HLA-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3105
NCBI-ProteinID: NP_001229687
OMIM: 142800
HGNC: 4931
Ensembl: ENSG00000206503
Vega: OTTHUMG00000130501
Pharos: P30443(Tbio)
UniProt: P30443 Q5SUL5
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 365 aa AA seqDB search
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQ
IMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQR
RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc
cagacctgggcgggctcccactccatgaggtatttcttcacatccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaagatggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccaggagacacggaatatgaaggcccactcacagactgaccgagcg
aacctggggaccctgcgcggctactacaaccagagcgaggacggttctcacaccatccag
ataatgtatggctgcgacgtggggccggacgggcgcttcctccgcgggtaccggcaggac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcttggaccgcggcg
gacatggcagctcagatcaccaagcgcaagtgggaggcggtccatgcggcggagcagcgg
agagtctacctggagggccggtgcgtggacgggctccgcagatacctggagaacgggaag
gagacgctgcagcgcacggacccccccaagacacatatgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga
tacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgagatgggagctg
tcttcccagcccaccatccccatcgtgggcatcattgctggcctggttctccttggagct
gtgatcactggagctgtggtcgctgccgtgatgtggaggaggaagagctcagatagaaaa
ggagggagttacactcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acagcttgtaaagtgtga

KEGG   Homo sapiens (human): 3106Help
Entry
3106              CDS       T01001                                 

Gene name
HLA-B, AS, B-4901, HLAB
Definition
(RefSeq) major histocompatibility complex, class I, B
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01476  Behcet disease
H01507  Seronegative arthritis
H01674  Ankylosing spondylitis
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3106 (HLA-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3106 (HLA-B)
   04145 Phagosome
    3106 (HLA-B)
  09143 Cell growth and death
   04218 Cellular senescence
    3106 (HLA-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3106 (HLA-B)
   04612 Antigen processing and presentation
    3106 (HLA-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3106 (HLA-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3106 (HLA-B)
   05330 Allograft rejection
    3106 (HLA-B)
   05332 Graft-versus-host disease
    3106 (HLA-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3106 (HLA-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3106 (HLA-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3106 (HLA-B)
   05170 Human immunodeficiency virus 1 infection
    3106 (HLA-B)
   05168 Herpes simplex virus 1 infection
    3106 (HLA-B)
   05163 Human cytomegalovirus infection
    3106 (HLA-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3106 (HLA-B)
   05169 Epstein-Barr virus infection
    3106 (HLA-B)
   05165 Human papillomavirus infection
    3106 (HLA-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3106 (HLA-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3106 (HLA-B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3106 (HLA-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3106 (HLA-B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3106
NCBI-ProteinID: NP_005505
OMIM: 142830
HGNC: 4932
Ensembl: ENSG00000234745
Vega: OTTHUMG00000031153
Pharos: P01889(Tbio)
UniProt: P01889 E5FQ95
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 362 aa AA seqDB search
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatctcagtgggctacgtggacgacacccagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccggaacacacagatctacaaggcccaggcacagactgaccgagag
agcctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
agcatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggcatgaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagcgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gacaagctggagcgcgctgaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggtttctaccctgcggagatcacactgacc
tggcagcgggatggcgaggaccaaactcaggacactgagcttgtggagaccagaccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgagatgggagccg
tcttcccagtccaccgtccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggagctgtggtcgctgctgtgatgtgtaggaggaagagttcaggtggaaaa
ggagggagctactctcaggctgcgtgcagcgacagtgcccagggctctgatgtgtctctc
acagcttga

KEGG   Homo sapiens (human): 3107Help
Entry
3107              CDS       T01001                                 

Gene name
HLA-C, D6S204, HLA-JY3, HLAC, HLC-C, MHC, PSORS1
Definition
(RefSeq) major histocompatibility complex, class I, C
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01656  Psoriasis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3107 (HLA-C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3107 (HLA-C)
   04145 Phagosome
    3107 (HLA-C)
  09143 Cell growth and death
   04218 Cellular senescence
    3107 (HLA-C)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3107 (HLA-C)
   04612 Antigen processing and presentation
    3107 (HLA-C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3107 (HLA-C)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3107 (HLA-C)
   05330 Allograft rejection
    3107 (HLA-C)
   05332 Graft-versus-host disease
    3107 (HLA-C)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3107 (HLA-C)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3107 (HLA-C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3107 (HLA-C)
   05170 Human immunodeficiency virus 1 infection
    3107 (HLA-C)
   05168 Herpes simplex virus 1 infection
    3107 (HLA-C)
   05163 Human cytomegalovirus infection
    3107 (HLA-C)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3107 (HLA-C)
   05169 Epstein-Barr virus infection
    3107 (HLA-C)
   05165 Human papillomavirus infection
    3107 (HLA-C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3107 (HLA-C)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3107 (HLA-C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3107 (HLA-C)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3107 (HLA-C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 MHC_I_3 ig DUF4448 FeoB_associated
Motif
Other DBs
NCBI-GeneID: 3107
NCBI-ProteinID: NP_002108
OMIM: 142840
HGNC: 4933
Ensembl: ENSG00000204525
Vega: OTTHUMG00000031154
Pharos: P10321(Tbio)
UniProt: P10321 Q6R739 Q95HC2
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 366 aa AA seqDB search
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgagccctcctcctgctgctctcgggaggcctggccctgacc
gagacctgggcctgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggc
cgcggagagccccgcttcatctcagtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacacagaagtacaagcgccaggcacaggctgaccgagtg
agcctgcggaacctgcgcggctactacaaccagagcgaggacgggtctcacaccctccag
aggatgtctggctgcgacctggggcccgacgggcgcctcctccgcgggtatgaccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacaccgcggctcagatcacccagcgcaagttggaggcggcccgtgcggcggagcagctg
agagcctacctggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagaacccccaaagacacacgtgacccaccaccccctctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacaccgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagctgggagcca
tcttcccagcccaccatccccatcatgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtccttggagctgtggtcaccgctatgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcatcacttgtaaagcctga

KEGG   Homo sapiens (human): 3133Help
Entry
3133              CDS       T01001                                 

Gene name
HLA-E, HLA-6.2, QA1
Definition
(RefSeq) major histocompatibility complex, class I, E
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3133 (HLA-E)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3133 (HLA-E)
   04145 Phagosome
    3133 (HLA-E)
  09143 Cell growth and death
   04218 Cellular senescence
    3133 (HLA-E)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3133 (HLA-E)
   04612 Antigen processing and presentation
    3133 (HLA-E)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3133 (HLA-E)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3133 (HLA-E)
   05330 Allograft rejection
    3133 (HLA-E)
   05332 Graft-versus-host disease
    3133 (HLA-E)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3133 (HLA-E)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3133 (HLA-E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3133 (HLA-E)
   05170 Human immunodeficiency virus 1 infection
    3133 (HLA-E)
   05168 Herpes simplex virus 1 infection
    3133 (HLA-E)
   05163 Human cytomegalovirus infection
    3133 (HLA-E)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3133 (HLA-E)
   05169 Epstein-Barr virus infection
    3133 (HLA-E)
   05165 Human papillomavirus infection
    3133 (HLA-E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3133 (HLA-E)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3133 (HLA-E)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3133 (HLA-E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3133 (HLA-E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 MHC_I_C C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3133
NCBI-ProteinID: NP_005507
OMIM: 143010
HGNC: 4962
Ensembl: ENSG00000204592
Vega: OTTHUMG00000031155
Pharos: P13747(Tbio)
UniProt: P13747 O19682 A8K8M6
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 358 aa AA seqDB search
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDND
AASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMH
GCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAY
LEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQ
DGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQ
PTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtagatggaaccctccttttactcctctcggaggccctggcccttacccagacctgg
gcgggctcccactccttgaagtatttccacacttccgtgtcccggcccggccgcggggag
ccccgcttcatctctgtgggctacgtggacgacacccagttcgtgcgcttcgacaacgac
gccgcgagtccgaggatggtgccgcgggcgccgtggatggagcaggaggggtcagagtat
tgggaccgggagacacggagcgccagggacaccgcacagattttccgagtgaatctgcgg
acgctgcgcggctactacaatcagagcgaggccgggtctcacaccctgcagtggatgcat
ggctgcgagctggggcccgacgggcgcttcctccgcgggtatgaacagttcgcctacgac
ggcaaggattatctcaccctgaatgaggacctgcgctcctggaccgcggtggacacggcg
gctcagatctccgagcaaaagtcaaatgatgcctctgaggcggagcaccagagagcctac
ctggaagacacatgcgtggagtggctccacaaatacctggagaaggggaaggagacgctg
cttcacctggagcccccaaagacacacgtgactcaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcag
gatggggagggccatacccaggacacggagctcgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgc
catgtgcagcatgaggggctacccgagcccgtcaccctgagatggaagccggcttcccag
cccaccatccccatcgtgggcatcattgctggcctggttctccttggatctgtggtctct
ggagctgtggttgctgctgtgatatggaggaagaagagctcaggtggaaaaggagggagc
tactctaaggctgagtggagcgacagtgcccaggggtctgagtctcacagcttgtaa

KEGG   Homo sapiens (human): 3134Help
Entry
3134              CDS       T01001                                 

Gene name
HLA-F, CDA12, HLA-5.4, HLA-CDA12, HLAF
Definition
(RefSeq) major histocompatibility complex, class I, F
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3134 (HLA-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3134 (HLA-F)
   04145 Phagosome
    3134 (HLA-F)
  09143 Cell growth and death
   04218 Cellular senescence
    3134 (HLA-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3134 (HLA-F)
   04612 Antigen processing and presentation
    3134 (HLA-F)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3134 (HLA-F)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3134 (HLA-F)
   05330 Allograft rejection
    3134 (HLA-F)
   05332 Graft-versus-host disease
    3134 (HLA-F)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3134 (HLA-F)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3134 (HLA-F)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3134 (HLA-F)
   05170 Human immunodeficiency virus 1 infection
    3134 (HLA-F)
   05168 Herpes simplex virus 1 infection
    3134 (HLA-F)
   05163 Human cytomegalovirus infection
    3134 (HLA-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3134 (HLA-F)
   05169 Epstein-Barr virus infection
    3134 (HLA-F)
   05165 Human papillomavirus infection
    3134 (HLA-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3134 (HLA-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3134 (HLA-F)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3134 (HLA-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3134 (HLA-F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 Ig_2 DUF357 MHC_I_C
Motif
Other DBs
NCBI-GeneID: 3134
NCBI-ProteinID: NP_061823
OMIM: 143110
HGNC: 4963
Ensembl: ENSG00000204642
Vega: OTTHUMG00000031156
Pharos: P30511(Tbio)
UniProt: P30511 Q5JZ47
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 346 aa AA seqDB search
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgaagcctcctcctgctgctctcaggggccctggccctgaccgatacttgg
gcgggctcccactccttgaggtatttcagcaccgctgtgtcgcggcccggccgcggggag
ccccgctacatcgccgtggagtacgtagacgacacgcaattcctgcggttcgacagcgac
gccgcgattccgaggatggagccgcgggagccgtgggtggagcaagaggggccgcagtat
tgggagtggaccacagggtacgccaaggccaacgcacagactgaccgagtggccctgagg
aacctgctccgccgctacaaccagagcgaggctgggtctcacaccctccagggaatgaat
ggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcacgcgtacgac
ggcaaggattacatctccctgaacgaggacctgcgctcctggaccgcggcggacaccgtg
gctcagatcacccagcgcttctatgaggcagaggaatatgcagaggagttcaggacctac
ctggagggcgagtgcctggagttgctccgcagatacttggagaatgggaaggagacgcta
cagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacgctgacctggcagcgg
gatggggaggaacagacccaggacacagagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggccgctgtggtggtgcctcctggagaggaacagagatacacatgc
catgtgcagcacgaggggctgccccagcccctcatcctgagatgggagcagtctccccag
cccaccatccccatcgtgggcatcgttgctggccttgttgtccttggagctgtggtcact
ggagctgtggtcgctgctgtgatgtggaggaagaagagctcagatagaaacagagggagc
tactctcaggctgcagtgtga

KEGG   Homo sapiens (human): 3135Help
Entry
3135              CDS       T01001                                 

Gene name
HLA-G, MHC-G
Definition
(RefSeq) major histocompatibility complex, class I, G
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3135 (HLA-G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3135 (HLA-G)
   04145 Phagosome
    3135 (HLA-G)
  09143 Cell growth and death
   04218 Cellular senescence
    3135 (HLA-G)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3135 (HLA-G)
   04612 Antigen processing and presentation
    3135 (HLA-G)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3135 (HLA-G)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3135 (HLA-G)
   05330 Allograft rejection
    3135 (HLA-G)
   05332 Graft-versus-host disease
    3135 (HLA-G)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3135 (HLA-G)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3135 (HLA-G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3135 (HLA-G)
   05170 Human immunodeficiency virus 1 infection
    3135 (HLA-G)
   05168 Herpes simplex virus 1 infection
    3135 (HLA-G)
   05163 Human cytomegalovirus infection
    3135 (HLA-G)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3135 (HLA-G)
   05169 Epstein-Barr virus infection
    3135 (HLA-G)
   05165 Human papillomavirus infection
    3135 (HLA-G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3135 (HLA-G)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3135 (HLA-G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3135 (HLA-G)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3135 (HLA-G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 C2-set_2 ig SNO
Motif
Other DBs
NCBI-GeneID: 3135
NCBI-ProteinID: NP_002118
OMIM: 142871
HGNC: 4964
Ensembl: ENSG00000204632
Vega: OTTHUMG00000031157
Pharos: P17693(Tbio)
UniProt: P17693 Q6DU14
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 338 aa AA seqDB search
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatggcgccccgaaccctcttcctgctgctctcgggggccctgaccctgacc
gagacctgggcgggctcccactccatgaggtatttcagcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccatgggctacgtggacgacacgcagttcgtgcggttc
gacagcgactcggcgtgtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaagaggagacacggaacaccaaggcccacgcacagactgacagaatg
aacctgcagaccctgcgcggctactacaaccagagcgaggccagttctcacaccctccag
tggatgattggctgcgacctggggtccgacggacgcctcctccgcgggtatgaacagtat
gcctacgatggcaaggattacctcgccctgaacgaggacctgcgctcctggaccgcagcg
gacactgcggctcagatctccaagcgcaagtgtgaggcggccaatgtggctgaacaaagg
agagcctacctggagggcacgtgcgtggagtggctccacagatacctggagaacgggaag
gagatgctgcagcgcgcggacccccccaagacacacgtgacccaccaccctgtctttgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcatactgacc
tggcagcgggatggggaggaccagacccaggacgtggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcatgctgagatggaagcag
tcttccctgcccaccatccccatcatgggtatcgttgctggcctggttgtccttgcagct
gtagtcactggagctgcggtcgctgctgtgctgtggagaaagaagagctcagattga

DBGET integrated database retrieval system