KEGG   Homo sapiens (human): 3360
Entry
3360              CDS       T01001                                 

Gene name
HTR4, 5-HT4, 5-HT4R
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Fabesetron hydrochloride: D01838
Mosapride (DG01285): D01994<JP> D08236
Naronapride (DG01335): D09933 D09934
Piboserod hydrochloride: D05471
Prucalopride (DG00080): D09205 D10152<US>
Relenopride (DG02948): D11220 D11221
Renzapride: D06396
Sulamserod hydrochloride: D05941
Tegaserod (DG00081): D02730<US> D06056
Velusetrag (DG01336): D09693 D09694
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3360 (HTR4)
   04024 cAMP signaling pathway
    3360 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3360 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3360 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3360 (HTR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3360 (HTR4)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 3360
NCBI-ProteinID: NP_000861
OMIM: 602164
HGNC: 5299
Ensembl: ENSG00000164270
Vega: OTTHUMG00000129931
Pharos: Q13639(Tclin)
UniProt: Q13639 A0A2D3FAF9
LinkDB
Position
5q32
AA seq 388 aa
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttctgaggagggtttcgggtcagtggagaaggtg
gtgctgctcacgtttctctcgacggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgctgggacaggcagctcaggaaaataaaaacaaattatttcattgta
tctcttgcttttgcggatctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggaggtgttttgtcttgttcggacatctctggac
gtcctgctcacaacggcatcgatttttcacctgtgctgcatttctctggataggtattac
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccacgtttatttcttttctccctataatgcaaggc
tggaataacattggcataattgatttgatagaaaagaggaagttcaaccagaactctaac
tctacgtactgtgtcttcatggtcaacaagccctacgccatcacctgctctgtggtggcc
ttctacatcccatttctcctcatggtgctggcctattaccgcatctatgtcacagctaag
gagcatgcccatcagatccagatgttacaacgggcaggagcctcctccgagagcaggcct
cagtcggcagaccagcatagcactcatcgcatgaggacagagaccaaagcagccaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggcaccattctttgtcaccaatatt
gtggatcctttcatagactacactgtccctgggcaggtgtggactgctttcctctggctc
ggctatatcaattccgggttgaacccttttctctacgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccttccattctg
ggccagactgtcccttgttcaaccacaaccattaatggatccacacatgtactaagggat
gcagtggagtgtggtggccagtgggagagtcagtgtcacccgccagcaacttctcctttg
gtggctgctcagcccagtgacacttag

KEGG   Homo sapiens (human): 3362
Entry
3362              CDS       T01001                                 

Gene name
HTR6, 5-HT6, 5-HT6R
Definition
(RefSeq) 5-hydroxytryptamine receptor 6
  KO
K04162  5-hydroxytryptamine receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Asenapine (DG03100): D02995<JP/US>
Cerlapirdine (DG01337): D10099 D10100
Idalopirdine (DG01878): D10710 D10747
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Tiospirone hydrochloride: D02688
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3362 (HTR6)
   04024 cAMP signaling pathway
    3362 (HTR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3362 (HTR6)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3362 (HTR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3362 (HTR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3362 (HTR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 3362
NCBI-ProteinID: NP_000862
OMIM: 601109
HGNC: 5301
Ensembl: ENSG00000158748
Vega: OTTHUMG00000002713
Pharos: P50406(Tchem)
UniProt: P50406
LinkDB
Position
1p36.13
AA seq 440 aa
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggtcccagagccgggcccaaccgccaatagcaccccggcctggggggcagggccgccg
tcggccccggggggcagcggctgggtggcggccgcgctgtgcgtggtcatcgcgctgacg
gcggcggccaactcgctgctgatcgcgctcatctgcactcagcccgcgctgcgcaacacg
tccaacttcttcctggtgtcgctcttcacgtctgacctgatggtggggctggtggtgatg
ccgccggccatgctgaacgcgctgtacgggcgctgggtgctggcgcgcggcctctgcctg
ctctggaccgccttcgacgtgatgtgctgcagcgcctccatcctcaacctctgcctcatc
agcctggaccgctacctgctcatcctctcgccgctgcgctacaagctgcgcatgacgccc
ctgcgtgccctggccctagtcctgggcgcctggagcctcgccgctctcgcctccttcctg
cccctgctgctgggctggcacgagctgggccacgcacggccacccgtccctggccagtgc
cgcctgctggccagcctgccttttgtccttgtggcgtcgggcctcaccttcttcctgccc
tcgggtgccatatgcttcacctactgcaggatcctgctagctgcccgcaagcaggccgtg
caggtggcctccctcaccaccggcatggccagtcaggcctcggagacgctgcaggtgccc
aggaccccacgcccaggggtggagtctgctgacagcaggcgtctagccacgaagcacagc
aggaaggccctgaaggccagcctgacgctgggcatcctgctgggcatgttctttgtgacc
tggttgcccttctttgtggccaacatagtccaggccgtgtgcgactgcatctccccaggc
ctcttcgatgtcctcacatggctgggttactgtaacagcaccatgaaccccatcatctac
ccactcttcatgcgggacttcaagcgggcgctgggcaggttcctgccatgtccacgctgt
ccccgggagcgccaggccagcctggcctcgccatcactgcgcacctctcacagcggcccc
cggcccggccttagcctacagcaggtgctgccgctgcccctgccgccggactcagattcg
gactcagacgcaggctcaggcggctcctcgggcctgcggctcacggcccagctgctgctt
cctggcgaggccacccaggaccccccgctgcccaccagggccgctgccgccgtcaatttc
ttcaacatcgaccccgcggagcccgagctgcggccgcatccacttggcatccccacgaac
tga

KEGG   Homo sapiens (human): 3363
Entry
3363              CDS       T01001                                 

Gene name
HTR7, 5-HT7
Definition
(RefSeq) 5-hydroxytryptamine receptor 7
  KO
K04163  5-hydroxytryptamine receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Asenapine (DG03100): D02995<JP/US>
Methysergide (DG00835): D00681 D02357
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3363 (HTR7)
   04020 Calcium signaling pathway
    3363 (HTR7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3363 (HTR7)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3363 (HTR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3363 (HTR7)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3363 (HTR7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 3363
NCBI-ProteinID: NP_062873
OMIM: 182137
HGNC: 5302
Ensembl: ENSG00000148680
Vega: OTTHUMG00000018732
Pharos: P34969(Tclin)
UniProt: P34969
LinkDB
Position
10q23.31
AA seq 479 aa
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgcccggacctctacgggcacctccgctctttcctt
ctgccagaagtggggcgcgggctgcccgacttgagccccgacggtggcgccgacccggtc
gcgggctcctgggcgccgcacctgctgagcgaggtgacagccagcccggcgcccacctgg
gacgcgcccccggacaatgcctccggctgtggggaacagatcaactacggcagagtcgag
aaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcgggcaactgc
ctggtggtgatctccgtgtgcttcgtcaagaagctccgccagccctccaactacctgatc
gtgtccctggcgctggccgacctctcggtggctgtggcggtcatgcccttcgtcagcgtc
accgacctcatcgggggcaagtggatctttggacactttttctgtaatgtcttcatcgcc
atggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagcattgacagg
taccttgggatcacaaggcccctcacataccctgtgaggcagaatgggaaatgcatggcg
aagatgattctctccgtctggcttctctccgcctccatcaccttacctccactctttgga
tgggctcagaatgtaaatgatgataaggtgtgcttgatcagccaggactttggctatacg
atttactctaccgcagtggcattttatatccccatgtccgtcatgcttttcatgtactac
cagatttacaaggctgccaggaagagtgctgccaaacacaagtttcctggcttccctcga
gtggagccagacagcgtcatcgccctgaatggcatagtgaagctccagaaggaggtggaa
gagtgtgcaaacctttcgagactcctcaagcatgaaaggaaaaacatctccatctttaag
cgagaacagaaagcagccaccaccctggggatcatcgtcggggcctttaccgtgtgctgg
ctgccatttttcctcctctcgacagccagacccttcatctgtggcacttcctgcagctgc
atcccactgtgggtggagaggacatttctgtggctaggctatgcaaactctctcattaac
ccttttatatatgccttcttcaaccgggacctgaggaccacctatcgcagcctgctccag
tgccagtaccggaatatcaaccggaagctctcagctgcaggcatgcatgaagccctgaag
cttgctgagaggccagagagacctgagtttgtgctgagggcctgcacaaggagggtgctg
ttgagaccagaaaagaggccaccggtatctgtgtgggtgctacaatctccagaccatcac
aattggttagcagacaaaatgctgactactgtagaaaaaaaggtcatgattcatgattga

DBGET integrated database retrieval system