KEGG   Homo sapiens (human): 3665Help
Entry
3665              CDS       T01001                                 

Gene name
IRF7, IMD39, IRF-7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00685  MV V to RIG-I-IRF7/3 signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3665 (IRF7)
   04621 NOD-like receptor signaling pathway
    3665 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    3665 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    3665 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3665 (IRF7)
  09172 Infectious disease: viral
   05162 Measles
    3665 (IRF7)
   05164 Influenza A
    3665 (IRF7)
   05161 Hepatitis B
    3665 (IRF7)
   05160 Hepatitis C
    3665 (IRF7)
   05168 Herpes simplex virus 1 infection
    3665 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3665 (IRF7)
   05169 Epstein-Barr virus infection
    3665 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3665 (IRF7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3665 (IRF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF
Motif
Other DBs
NCBI-GeneID: 3665
NCBI-ProteinID: NP_001563
OMIM: 605047
HGNC: 6122
Ensembl: ENSG00000185507
Vega: OTTHUMG00000132019
Pharos: Q92985(Tbio)
UniProt: Q92985
LinkDB All DBs
Position
11p15.5
AA seq 503 aa AA seqDB search
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccttggctcctgagagggcagccccacgcgtgctgttcggagagtggctccttgga
gagatcagcagcggctgctatgaggggctgcagtggctggacgaggcccgcacctgtttc
cgcgtgccctggaagcacttcgcgcgcaaggacctgagcgaggccgacgcgcgcatcttc
aaggcctgggctgtggcccgcggcaggtggccgcctagcagcaggggaggtggcccgccc
cccgaggctgagactgcggagcgcgccggctggaaaaccaacttccgctgcgcactgcgc
agcacgcgtcgcttcgtgatgctgcgggataactcgggggacccggccgacccgcacaag
gtgtacgcgctcagccgggagctgtgctggcgagaaggcccaggcacggaccagactgag
gcagaggcccccgcagctgtcccaccaccacagggtgggcccccagggccattcctggca
cacacacatgctggactccaagccccaggccccctccctgccccagctggtgacaagggg
gacctcctgctccaggcagtgcaacagagctgcctggcagaccatctgctgacagcgtca
tggggggcagatccagtcccaaccaaggctcctggagagggacaagaagggcttcccctg
actggggcctgtgctggaggcccagggctccctgctggggagctgtacgggtgggcagta
gagacgacccccagccccgggccccagcccgcggcactaacgacaggcgaggccgcggcc
ccagagtccccgcaccaggcagagccgtacctgtcaccctccccaagcgcctgcaccgcg
gtgcaagagcccagcccaggggcgctggacgtgaccatcatgtacaagggccgcacggtg
ctgcagaaggtggtgggacacccgagctgcacgttcctatacggccccccagacccagct
gtccgggccacagacccccagcaggtagcattccccagccctgccgagctcccggaccag
aagcagctgcgctacacggaggaactgctgcggcacgtggcccctgggttgcacctggag
cttcgggggccacagctgtgggcccggcgcatgggcaagtgcaaggtgtactgggaggtg
ggcggacccccaggctccgccagcccctccaccccagcctgcctgctgcctcggaactgt
gacacccccatcttcgacttcagagtcttcttccaagagctggtggaattccgggcacgg
cagcgccgtggctccccacgctataccatctacctgggcttcgggcaggacctgtcagct
gggaggcccaaggagaagagcctggtcctggtgaagctggaaccctggctgtgccgagtg
cacctagagggcacgcagcgtgagggtgtgtcttccctggatagcagcagcctcagcctc
tgcctgtccagcgccaacagcctctatgacgacatcgagtgcttccttatggagctggag
cagcccgcctag

KEGG   Homo sapiens (human): 5610Help
Entry
5610              CDS       T01001                                 

Gene name
EIF2AK2, EIF2AK1, PKR, PPP1R83, PRKR
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04217  Necroptosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06122  IFN signaling (viruses)
nt06138  PKR-eIF2alpha signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00571  PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00696  MV C to PKR-eIF2alpha signaling pathway
N00725  IAV NS1 to PKR-eIF2alpha signaling pathway
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5610 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5610 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5610 (EIF2AK2)
  09172 Infectious disease: viral
   05162 Measles
    5610 (EIF2AK2)
   05164 Influenza A
    5610 (EIF2AK2)
   05160 Hepatitis C
    5610 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    5610 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5610 (EIF2AK2)
   05169 Epstein-Barr virus infection
    5610 (EIF2AK2)
   05165 Human papillomavirus infection
    5610 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5610 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5610 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5610 (EIF2AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5610 (EIF2AK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   5610 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5610 (EIF2AK2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5610 (EIF2AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr dsrm Kinase-like Kdo DND1_DSRM Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 5610
NCBI-ProteinID: NP_001129123
OMIM: 176871
HGNC: 9437
Ensembl: ENSG00000055332
Vega: OTTHUMG00000100962
Pharos: P19525(Tbio)
UniProt: P19525 Q8IW76
LinkDB All DBs
Structure
PDB: 

Position
2p22.2
AA seq 551 aa AA seqDB search
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgatctttcagcaggtttcttcatggaggaacttaatacataccgtcagaag
cagggagtagtacttaaatatcaagaactgcctaattcaggacctccacatgataggagg
tttacatttcaagttataatagatggaagagaatttccagaaggtgaaggtagatcaaag
aaggaagcaaaaaatgccgcagccaaattagctgttgagatacttaataaggaaaagaag
gcagttagtcctttattattgacaacaacgaattcttcagaaggattatccatggggaat
tacataggccttatcaatagaattgcccagaagaaaagactaactgtaaattatgaacag
tgtgcatcgggggtgcatgggccagaaggatttcattataaatgcaaaatgggacagaaa
gaatatagtattggtacaggttctactaaacaggaagcaaaacaattggccgctaaactt
gcatatcttcagatattatcagaagaaacctcagtgaaatctgactacctgtcctctggt
tcttttgctactacgtgtgagtcccaaagcaactctttagtgaccagcacactcgcttct
gaatcatcatctgaaggtgacttctcagcagatacatcagagataaattctaacagtgac
agtttaaacagttcttcgttgcttatgaatggtctcagaaataatcaaaggaaggcaaaa
agatctttggcacccagatttgaccttcctgacatgaaagaaacaaagtatactgtggac
aagaggtttggcatggattttaaagaaatagaattaattggctcaggtggatttggccaa
gttttcaaagcaaaacacagaattgacggaaagacttacgttattaaacgtgttaaatat
aataacgagaaggcggagcgtgaagtaaaagcattggcaaaacttgatcatgtaaatatt
gttcactacaatggctgttgggatggatttgattatgatcctgagaccagtgatgattct
cttgagagcagtgattatgatcctgagaacagcaaaaatagttcaaggtcaaagactaag
tgccttttcatccaaatggaattctgtgataaagggaccttggaacaatggattgaaaaa
agaagaggcgagaaactagacaaagttttggctttggaactctttgaacaaataacaaaa
ggggtggattatatacattcaaaaaaattaattcatagagatcttaagccaagtaatata
ttcttagtagatacaaaacaagtaaagattggagactttggacttgtaacatctctgaaa
aatgatggaaagcgaacaaggagtaagggaactttgcgatacatgagcccagaacagatt
tcttcgcaagactatggaaaggaagtggacctctacgctttggggctaattcttgctgaa
cttcttcatgtatgtgacactgcttttgaaacatcaaagtttttcacagacctacgggat
ggcatcatctcagatatatttgataaaaaagaaaaaactcttctacagaaattactctca
aagaaacctgaggatcgacctaacacatctgaaatactaaggaccttgactgtgtggaag
aaaagcccagagaaaaatgaacgacacacatgttag

DBGET integrated database retrieval system