KEGG   Homo sapiens (human): 3674Help
Entry
3674              CDS       T01001                                 

Gene name
ITGA2B, BDPLT16, BDPLT2, CD41, CD41B, GP2B, GPIIb, GT, GTA, HPA3, PPP1R93
Definition
(RefSeq) integrin subunit alpha 2b
  KO
K06476  integrin alpha 2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00226  Glanzmann thrombasthenia
H01740  Macrothrombocytopenia
Drug target
Abciximab: D02778
Elarofiban: D03971
Eptifibatide: D06888
Lamifiban (DG01420): D04659 D04660
Lotrafiban hydrochloride: D04785
Orbofiban acetate: D05267
Roxifiban acetate: D05772
Sibrafiban: D05834
Tadocizumab: D06649
Tirofiban (DG00159): D01029 D08607
Xemilofiban hydrochloride: D06335
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3674 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    3674 (ITGA2B)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3674 (ITGA2B)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    3674 (ITGA2B)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3674 (ITGA2B)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3674 (ITGA2B)
   04611 Platelet activation
    3674 (ITGA2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3674 (ITGA2B)
   05222 Small cell lung cancer
    3674 (ITGA2B)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3674 (ITGA2B)
   05410 Hypertrophic cardiomyopathy (HCM)
    3674 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3674 (ITGA2B)
   05414 Dilated cardiomyopathy (DCM)
    3674 (ITGA2B)
  Infectious diseases
   05165 Human papillomavirus infection
    3674 (ITGA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3674 (ITGA2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3674 (ITGA2B)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3674 (ITGA2B)
CD molecules [BR:hsa04090]
 Proteins
  3674 (ITGA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3674
NCBI-ProteinID: NP_000410
OMIM: 607759
HGNC: 6138
Ensembl: ENSG00000005961
Vega: OTTHUMG00000177935
Pharos: P08514(Tclin)
UniProt: P08514
LinkDB All DBs
Structure
PDB: 

Position
17q21.31
AA seq 1039 aa AA seqDB search
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgcaagccctctggcttctggagtgggtgctgctgctc
ttgggaccttgtgctgcccctccagcctgggccttgaacctggacccagtgcagctcacc
ttctatgcaggccccaatggcagccagtttggattttcactggacttccacaaggacagc
catgggagagtggccatcgtggtgggcgccccgcggaccctgggccccagccaggaggag
acgggcggcgtgttcctgtgcccctggagggccgagggcggccagtgcccctcgctgctc
tttgacctccgtgatgagacccgaaatgtaggctcccaaactttacaaaccttcaaggcc
cgccaaggactgggggcgtcggtcgtcagctggagcgacgtcattgtggcctgcgccccc
tggcagcactggaacgtcctagaaaagactgaggaggctgagaagacgcccgtaggtagc
tgctttttggctcagccagagagcggccgccgcgccgagtactccccctgtcgcgggaac
accctgagccgcatttacgtggaaaatgattttagctgggacaagcgttactgtgaagcg
ggcttcagctccgtggtcactcaggccggagagctggtgcttggggctcctggcggctat
tatttcttaggtctcctggcccaggctccagttgcggatattttctcgagttaccgccca
ggcatccttttgtggcacgtgtcctcccagagcctctcctttgactccagcaacccagag
tacttcgacggctactgggggtactcggtggccgtgggcgagttcgacggggatctcaac
actacagaatatgtcgtcggtgcccccacttggagctggaccctgggagcggtggaaatt
ttggattcctactaccagaggctgcatcggctgcgcggagagcagatggcgtcgtatttt
gggcattcagtggctgtcactgacgtcaacggggatgggaggcatgatctgctggtgggc
gctccactgtatatggagagccgggcagaccgaaaactggccgaagtggggcgtgtgtat
ttgttcctgcagccgcgaggcccccacgcgctgggtgcccccagcctcctgctgactggc
acacagctctatgggcgattcggctctgccatcgcacccctgggcgacctcgaccgggat
ggctacaatgacattgcagtggctgccccctacgggggtcccagtggccggggccaagtg
ctggtgttcctgggtcagagtgaggggctgaggtcacgtccctcccaggtcctggacagc
cccttccccacaggctctgcctttggcttctcccttcgaggtgccgtagacatcgatgac
aacggatacccagacctgatcgtgggagcttacggggccaaccaggtggctgtgtacaga
gctcagccagtggtgaaggcctctgtccagctactggtgcaagattcactgaatcctgct
gtgaagagctgtgtcctacctcagaccaagacacccgtgagctgcttcaacatccagatg
tgtgttggagccactgggcacaacattcctcagaagctatccctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctgctgctgggctctcaacaggca
ggcaccaccctgaacctggatctgggcggaaagcacagccccatctgccacaccaccatg
gccttccttcgagatgaggcagacttccgggacaagctgagccccattgtgctcagcctc
aatgtgtccctaccgcccacggaggctggaatggcccctgctgtcgtgctgcatggagac
acccatgtgcaggagcagacacgaatcgtcctggactgtggggaagatgacgtatgtgtg
ccccagcttcagctcactgccagcgtgacgggctccccgctcctagttggggcagataat
gtcctggagctgcagatggacgcagccaacgagggcgagggggcctatgaagcagagctg
gccgtgcacctgccccagggcgcccactacatgcgggccctaagcaatgtcgagggcttt
gagagactcatctgtaatcagaagaaggagaatgagaccagggtggtgctgtgtgagctg
ggcaaccccatgaagaagaacgcccagataggaatcgcgatgttggtgagcgtggggaat
ctggaagaggctggggagtctgtgtccttccagctgcagatacggagcaagaacagccag
aatccaaacagcaagattgtgctgctggacgtgccggtccgggcagaggcccaagtggag
ctgcgagggaactcctttccagcctccctggtggtggcagcagaagaaggtgagagggag
cagaacagcttggacagctggggacccaaagtggagcacacctatgagctccacaacaat
ggccctgggactgtgaatggtcttcacctcagcatccaccttccgggacagtcccagccc
tccgacctgctctacatcctggatatacagccccaggggggccttcagtgcttcccacag
cctcctgtcaaccctctcaaggtggactgggggctgcccatccccagcccctcccccatt
cacccggcccatcacaagcgggatcgcagacagatcttcctgccagagcccgagcagccc
tcgaggcttcaggatccagttctcgtaagctgcgactcggcgccctgtactgtggtgcag
tgtgacctgcaggagatggcgcgcgggcagcgggccatggtcacggtgctggccttcctg
tggctgcccagcctctaccagaggcctctggatcagtttgtgctgcagtcgcacgcatgg
ttcaacgtgtcctccctcccctatgcggtgcccccgctcagcctgccccgaggggaagct
caggtgtggacacagctgctccgggccttggaggagagggccattccaatctggtgggtg
ctggtgggtgtgctgggtggcctgctgctgctcaccatcctggtcctggccatgtggaag
gtcggcttcttcaagcggaaccggccacccctggaagaagatgatgaagagggggagtga

DBGET integrated database retrieval system