KEGG   Homo sapiens (human): 5700
Entry
5700              CDS       T01001                                 

Gene name
PSMC1, P26S4, S4, p56
Definition
(RefSeq) proteasome 26S subunit, ATPase 1
  KO
K03062  26S proteasome regulatory subunit T2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (viruses)
nt06166  Human papillomavirus (HPV)
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00365  HPV E7 to cell cycle G1/S
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5700 (PSMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5700 (PSMC1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5700 (PSMC1)
   05012 Parkinson disease
    5700 (PSMC1)
   05014 Amyotrophic lateral sclerosis
    5700 (PSMC1)
   05016 Huntington disease
    5700 (PSMC1)
   05017 Spinocerebellar ataxia
    5700 (PSMC1)
   05020 Prion disease
    5700 (PSMC1)
   05022 Pathways of neurodegeneration - multiple diseases
    5700 (PSMC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5700 (PSMC1)
   05165 Human papillomavirus infection
    5700 (PSMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5700 (PSMC1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5700 (PSMC1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 IstB_IS21 AAA_25 ATPase AAA_28 AAA_33 AAA_3 RNA_helicase AAA_14 TIP49 Mg_chelatase PhoH AAA_7 Prot_ATP_OB_N NACHT AAA_24 NB-ARC AAA_30 ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 5700
NCBI-ProteinID: NP_002793
OMIM: 602706
HGNC: 9547
Ensembl: ENSG00000100764
Vega: OTTHUMG00000171019
Pharos: P62191(Tbio)
UniProt: P62191 Q53XL8
LinkDB
Structure
PDB: 

Position
14q32.11
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggtcctggaggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtaccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaactgccactggtgacacctcacactcagtgccggtta
aaattactgaagttagagagaattaaagactatcttctcatggaggaagaattcattaga
aatcaggaacaaatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctgagggggaccccgatgtcagtaggaaccttggaagagatcattgatgacaatcat
gccatcgtgtctacatctgtgggctcagaacactacgtcagcattctttcatttgtagac
aaggatctgctggaacctggctgctcggtcctgctcaaccacaaggtgcatgccgtgata
ggggtgctgatggatgacacggatcccctggtcacagtgatgaaggtagaaaaggccccc
caggagacctatgcagatattggggggttggacaaccaaattcaggaaattaaggaatct
gtggagcttcctctcacccatcctgaatattatgaagagatgggtataaagcctcctaag
ggggtcattctctatggtccacctggcacaggtaaaaccttgttagccaaagcagtagca
aaccaaacctcagccactttcttgagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgtacgggaattgttccgagttgctgaagaacatgcaccgtcc
atcgtgtttattgatgaaattgacgccattgggacaaaaagatatgactccaattctggt
ggtgagagagaaattcagcgaacaatgttggaactgctgaaccagttggatggatttgat
tctaggggagatgtgaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacaggaagattgagttccccctgcctgatgaaaagacg
aagaagcgcatctttcagattcacacaagcaggatgacgctggctgatgatgtaaccctg
gacgacctgatcatggctaaagatgacctctctggtgctgacatcaaggcaatctgtaca
gaagctggtctgatggccttaagagaacgtagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagaaaatgttctttataagaaacaggaaggcacccctgaggggctgtatctc
taa

DBGET integrated database retrieval system