KEGG   Homo sapiens (human): 7168
Entry
7168              CDS       T01001                                 

Gene name
TPM1, C15orf13, CMD1Y, CMH3, HEL-S-265, HTM-alpha, LVNC9, TMSA
Definition
(RefSeq) tropomyosin 1
  KO
K10373  tropomyosin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05206  MicroRNAs in cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
H01216  Left ventricular noncompaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7168 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    7168 (TPM1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    7168 (TPM1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    7168 (TPM1)
   05414 Dilated cardiomyopathy
    7168 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7168 (TPM1)
   04147 Exosome [BR:hsa04147]
    7168 (TPM1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7168 (TPM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   7168 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II TMF_DNA_bd ERM ATG16 COG2 AAA_13 DUF745 CENP-F_leu_zip XhlA SlyX Laminin_I DUF1664 Fib_alpha
Other DBs
NCBI-GeneID: 7168
NCBI-ProteinID: NP_000357
OMIM: 191010
HGNC: 12010
Ensembl: ENSG00000140416
Vega: OTTHUMG00000132803
Pharos: P09493(Tbio)
UniProt: P09493 A0A0K0K1I0
LinkDB
Position
15q22.2
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagctgagcaggcggaggccgacaagaaggcggcggaagacaggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tctgaggctctcaaagatgcccaggagaagctggagctggcagagaaaaaggccaccgat
gctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggccaagtccgacagctggaagaacaattaagaataatg
gatcagaccttgaaagcattaatggctgcagaggataagtactcgcagaaggaagacaga
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

KEGG   Homo sapiens (human): 7169
Entry
7169              CDS       T01001                                 

Gene name
TPM2, AMCD1, DA1, DA2B, DA2B4, HEL-S-273, NEM4, TMSB
Definition
(RefSeq) tropomyosin 2
  KO
K10374  tropomyosin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00698  Nemaline myopathy
H00702  Cap myopathy
H00811  Distal arthrogryposis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7169 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    7169 (TPM2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    7169 (TPM2)
   05414 Dilated cardiomyopathy
    7169 (TPM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7169 (TPM2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7169 (TPM2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ ERM Crescentin TMF_DNA_bd CENP-F_leu_zip YscO Cluap1 HrpB7 MscS_porin ATG16 SlyX FlaC_arch DUF16 Golgin_A5 Suppressor_APC DUF1664 ADIP Spc7
Other DBs
NCBI-GeneID: 7169
NCBI-ProteinID: NP_003280
OMIM: 190990
HGNC: 12011
Ensembl: ENSG00000198467
Vega: OTTHUMG00000019878
Pharos: P07951(Tbio)
UniProt: P07951
LinkDB
Position
9p13.3
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccatcgac
cgcgccgagcaggccgaagccgacaagaagcaagctgaggaccgctgcaagcagctggag
gaggagcagcaggccctccagaagaagctgaaggggacagaggatgaggtggaaaagtat
tctgaatccgtgaaggaggcccaggagaaactggagcaggccgagaagaaggccactgat
gctgaggcagatgtggcctccctgaaccgccgcattcagctggttgaggaggagctggac
cgggcccaggagcgcctggctacagccctgcagaagctggaggaggccgagaaggcggct
gatgagagcgagagaggaatgaaggtcatcgaaaaccgggccatgaaggatgaggagaag
atggaactgcaggagatgcagctgaaggaggccaagcacatcgctgaggattcagaccgc
aaatatgaagaggtggccaggaagctggtgatcctggaaggagagctggagcgctcggag
gagagggctgaggtggccgagagtaaatgtggggacctagaggaggagctgaaaattgtt
accaacaacttgaaatccctggaggcccaggcggacaagtattccaccaaagaagataaa
tatgaagaggagatcaaactgttggaggagaagctgaaggaggctgagacccgagcagag
tttgccgagaggtctgtggcaaagttggagaaaaccatcgatgacctagaagatgaagtc
tatgcccagaagatgaagtacaaggccattagcgaggaactggacaacgcactcaatgac
atcacctccctctga

KEGG   Homo sapiens (human): 7170
Entry
7170              CDS       T01001                                 

Gene name
TPM3, CAPM1, CFTD, HEL-189, HEL-S-82p, NEM1, OK/SW-cl.5, TM-5, TM3, TM30, TM30nm, TM5, TPM3nu, TPMsk3, TRK, hscp30
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00032  Thyroid cancer
H00698  Nemaline myopathy
H00701  Congenital fiber type disproportion
H00702  Cap myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7170 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    7170 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7170 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    7170 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    7170 (TPM3)
   05414 Dilated cardiomyopathy
    7170 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7170 (TPM3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7170 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM DUF745 Crescentin CENP-F_leu_zip XhlA DUF3450 ATG16 HrpB7 DHR10 DUF1664 SlyX Golgin_A5 Laminin_I AAA_13 DUF16 MAD
Other DBs
NCBI-GeneID: 7170
NCBI-ProteinID: NP_689476
OMIM: 191030
HGNC: 12012
Ensembl: ENSG00000143549
Vega: OTTHUMG00000035853
Pharos: P06753(Tbio)
UniProt: P06753
LinkDB
Structure
PDB: 
6OTN

Position
1q21.3
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaggagaatgctctg
gatcgggcagagcaagctgaagctgagcagaagcaggcagaagaaagaagtaaacagctg
gaggatgagctggcagccatgcagaagaagctgaaagggacagaggatgagctggacaag
tattctgaagctttgaaggatgcccaggagaagctggaactggcagagaagaaggctgct
gatgctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaagaagagctg
gaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagctgaaaaagct
gctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaagatgaagaa
aagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaagaggcagat
aggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttggaacgcaca
gaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagat
aaatatgaggaagaaatcaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgagagatcggtagccaagctggaaaagacaattgatgacctggaagatgag
ctctatgcccagaaactgaagtacaaggccattagcgaggagctggaccacgccctcaat
gacatgacctctatataa

KEGG   Homo sapiens (human): 7171
Entry
7171              CDS       T01001                                 

Gene name
TPM4, HEL-S-108
Definition
(RefSeq) tropomyosin 4
  KO
K10375  tropomyosin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7171 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    7171 (TPM4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    7171 (TPM4)
   05414 Dilated cardiomyopathy
    7171 (TPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7171 (TPM4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7171 (TPM4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II DUF3450 CENP-F_leu_zip Crescentin CCDC144C FPP TMF_DNA_bd HrpB7 DUF724 PspA_IM30 DHR10 MscS_porin EzrA DUF1664 XhlA CALCOCO1 Fib_alpha DUF745 TPR_MLP1_2 ADIP Lebercilin DUF948 GAS
Other DBs
NCBI-GeneID: 7171
NCBI-ProteinID: NP_003281
OMIM: 600317
HGNC: 12013
Ensembl: ENSG00000167460
Vega: OTTHUMG00000182134
Pharos: P67936(Tbio)
UniProt: P67936 V9HW56
LinkDB
Position
19p13.12-p13.11
AA seq 248 aa
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAE
EADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSE
KEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQ
TLNELNCI
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccggcctcaactccctggaggcggtgaaacgcaagatccaggccctgcagcagcag
gcggacgaggcggaagaccgcgcgcagggcctgcagcgggagctggacggcgagcgcgag
cggcgcgagaaagctgaaggtgatgtggccgccctcaaccgacgcatccagctcgttgag
gaggagttggacagggctcaggaacgactggccacggccctgcagaagctggaggaggca
gaaaaagctgcagatgagagtgagagaggaatgaaggtgatagaaaaccgggccatgaag
gatgaggagaagatggagattcaggagatgcagctcaaagaggccaagcacattgcggaa
gaggctgaccgcaaatacgaggaggtagctcgtaagctggtcatcctggagggtgagctg
gagagggcagaggagcgtgcggaggtgtctgaactaaaatgtggtgacctggaagaagaa
ctcaagaatgttactaacaatctgaaatctctggaggctgcatctgaaaagtattctgaa
aaggaggacaaatatgaagaagaaattaaacttctgtctgacaaactgaaagaggctgag
acccgtgctgaatttgcagagagaacggttgcaaaactggaaaagacaattgatgacctg
gaagagaaacttgcccaggccaaagaagagaacgtgggcttacatcagacactggatcag
acactaaacgaacttaactgtatataa

DBGET integrated database retrieval system