KEGG   Homo sapiens (human): 727
Entry
727               CDS       T01001                                 

Gene name
C5, C5D, C5a, C5b, CPAMD4, ECLZB
Definition
(RefSeq) complement C5
  KO
K03994  complement component 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05168  Herpes simplex virus 1 infection
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Drug target
Avacincaptad pegol sodium: D11748
Crovalimab: D11696
Eculizumab: D03940<JP/US>
Nomacopan: D11473
Olendalizumab: D11331
Pexelizumab: D10023
Pozelimab: D11477
Ravulizumab: D11054<JP/US>
Vilobelimab: D11838
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    727 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    727 (C5)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    727 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    727 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    727 (C5)
   05150 Staphylococcus aureus infection
    727 (C5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    727 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    727 (C5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   727 (C5)
SSDB
Motif
Pfam: TED_complement MG1 A2M A2M_BRD A2M_recep NTR MG4 MG2 MG3 ANATO DUF4165
Other DBs
NCBI-GeneID: 727
NCBI-ProteinID: NP_001726
OMIM: 120900
HGNC: 1331
Ensembl: ENSG00000106804
Vega: OTTHUMG00000020579
Pharos: P01031(Tclin)
CPD: C16510
UniProt: P01031
LinkDB
Structure
PDB: 

Position
9q33.2
AA seq 1676 aa
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
NT seq 5031 nt   +upstreamnt  +downstreamnt
atgggccttttgggaatactttgttttttaatcttcctggggaaaacctggggacaggag
caaacatatgtcatttcagcaccaaaaatattccgtgttggagcatctgaaaatattgtg
attcaagtttatggatacactgaagcatttgatgcaacaatctctattaaaagttatcct
gataaaaaatttagttactcctcaggccatgttcatttatcctcagagaataaattccaa
aactctgcaatcttaacaatacaaccaaaacaattgcctggaggacaaaacccagtttct
tatgtgtatttggaagttgtatcaaagcatttttcaaaatcaaaaagaatgccaataacc
tatgacaatggatttctcttcattcatacagacaaacctgtttatactccagaccagtca
gtaaaagttagagtttattcgttgaatgacgacttgaagccagccaaaagagaaactgtc
ttaactttcatagatcctgaaggatcagaagttgacatggtagaagaaattgatcatatt
ggaattatctcttttcctgacttcaagattccgtctaatcctagatatggtatgtggacg
atcaaggctaaatataaagaggacttttcaacaactggaaccgcatattttgaagttaaa
gaatatgtcttgccacatttttctgtctcaatcgagccagaatataatttcattggttac
aagaactttaagaattttgaaattactataaaagcaagatatttttataataaagtagtc
actgaggctgacgtttatatcacatttggaataagagaagacttaaaagatgatcaaaaa
gaaatgatgcaaacagcaatgcaaaacacaatgttgataaatggaattgctcaagtcaca
tttgattctgaaacagcagtcaaagaactgtcatactacagtttagaagatttaaacaac
aagtacctttatattgctgtaacagtcatagagtctacaggtggattttctgaagaggca
gaaatacctggcatcaaatatgtcctctctccctacaaactgaatttggttgctactcct
cttttcctgaagcctgggattccatatcccatcaaggtgcaggttaaagattcgcttgac
cagttggtaggaggagtcccagtaacactgaatgcacaaacaattgatgtaaaccaagag
acatctgacttggatccaagcaaaagtgtaacacgtgttgatgatggagtagcttccttt
gtgcttaatctcccatctggagtgacggtgctggagtttaatgtcaaaactgatgctcca
gatcttccagaagaaaatcaggccagggaaggttaccgagcaatagcatactcatctctc
agccaaagttacctttatattgattggactgataaccataaggctttgctagtgggagaa
catctgaatattattgttacccccaaaagcccatatattgacaaaataactcactataat
tacttgattttatccaagggcaaaattatccactttggcacgagggagaaattttcagat
gcatcttatcaaagtataaacattccagtaacacagaacatggttccttcatcccgactt
ctggtctattacatcgtcacaggagaacagacagcagaattagtgtctgattcagtctgg
ttaaatattgaagaaaaatgtggcaaccagctccaggttcatctgtctcctgatgcagat
gcatattctccaggccaaactgtgtctcttaatatggcaactggaatggattcctgggtg
gcattagcagcagtggacagtgctgtgtatggagtccaaagaggagccaaaaagcccttg
gaaagagtatttcaattcttagagaagagtgatctgggctgtggggcaggtggtggcctc
aacaatgccaatgtgttccacctagctggacttaccttcctcactaatgcaaatgcagat
gactcccaagaaaatgatgaaccttgtaaagaaattctcaggccaagaagaacgctgcaa
aagaagatagaagaaatagctgctaaatataaacattcagtagtgaagaaatgttgttac
gatggagcctgcgttaataatgatgaaacctgtgagcagcgagctgcacggattagttta
gggccaagatgcatcaaagctttcactgaatgttgtgtcgtcgcaagccagctccgtgct
aatatctctcataaagacatgcaattgggaaggctacacatgaagaccctgttaccagta
agcaagccagaaattcggagttattttccagaaagctggttgtgggaagttcatcttgtt
cccagaagaaaacagttgcagtttgccctacctgattctctaaccacctgggaaattcaa
ggcgttggcatttcaaacactggtatatgtgttgctgatactgtcaaggcaaaggtgttc
aaagatgtcttcctggaaatgaatataccatattctgttgtacgaggagaacagatccaa
ttgaaaggaactgtttacaactataggacttctgggatgcagttctgtgttaaaatgtct
gctgtggagggaatctgcacttcggaaagcccagtcattgatcatcagggcacaaagtcc
tccaaatgtgtgcgccagaaagtagagggctcctccagtcacttggtgacattcactgtg
cttcctctggaaattggccttcacaacatcaatttttcactggagacttggtttggaaaa
gaaatcttagtaaaaacattacgagtggtgccagaaggtgtcaaaagggaaagctattct
ggtgttactttggatcctaggggtatttatggtaccattagcagacgaaaggagttccca
tacaggatacccttagatttggtccccaaaacagaaatcaaaaggattttgagtgtaaaa
ggactgcttgtaggtgagatcttgtctgcagttctaagtcaggaaggcatcaatatccta
acccacctccccaaagggagtgcagaggcggagctgatgagcgttgtcccagtattctat
gtttttcactacctggaaacaggaaatcattggaacatttttcattctgacccattaatt
gaaaagcagaaactgaagaaaaaattaaaagaagggatgttgagcattatgtcctacaga
aatgctgactactcttacagtgtgtggaagggtggaagtgctagcacttggttaacagct
tttgctttaagagtacttggacaagtaaataaatacgtagagcagaaccaaaattcaatt
tgtaattctttattgtggctagttgagaattatcaattagataatggatctttcaaggaa
aattcacagtatcaaccaataaaattacagggtaccttgcctgttgaagcccgagagaac
agcttatatcttacagcctttactgtgattggaattagaaaggctttcgatatatgcccc
ctggtgaaaatcgacacagctctaattaaagctgacaactttctgcttgaaaatacactg
ccagcccagagcacctttacattggccatttctgcgtatgctctttccctgggagataaa
actcacccacagtttcgttcaattgtttcagctttgaagagagaagctttggttaaaggt
aatccacccatttatcgtttttggaaagacaatcttcagcataaagacagctctgtacct
aacactggtacggcacgtatggtagaaacaactgcctatgctttactcaccagtctgaac
ttgaaagatataaattatgttaacccagtcatcaaatggctatcagaagagcagaggtat
ggaggtggcttttattcaacccaggacacaatcaatgccattgagggcctgacggaatat
tcactcctggttaaacaactccgcttgagtatggacatcgatgtttcttacaagcataaa
ggtgccttacataattataaaatgacagacaagaatttccttgggaggccagtagaggtg
cttctcaatgatgacctcattgtcagtacaggatttggcagtggcttggctacagtacat
gtaacaactgtagttcacaaaaccagtacctctgaggaagtttgcagcttttatttgaaa
atcgatactcaggatattgaagcatcccactacagaggctacggaaactctgattacaaa
cgcatagtagcatgtgccagctacaagcccagcagggaagaatcatcatctggatcctct
catgcggtgatggacatctccttgcctactggaatcagtgcaaatgaagaagacttaaaa
gcccttgtggaaggggtggatcaactattcactgattaccaaatcaaagatggacatgtt
attctgcaactgaattcgattccctccagtgatttcctttgtgtacgattccggatattt
gaactctttgaagttgggtttctcagtcctgccactttcacagtgtacgaataccacaga
ccagataaacagtgtaccatgttttatagcacttccaatatcaaaattcagaaagtctgt
gaaggagccgcgtgcaagtgtgtagaagctgattgtgggcaaatgcaggaagaattggat
ctgacaatctctgcagagacaagaaaacaaacagcatgtaaaccagagattgcatatgct
tataaagttagcatcacatccatcactgtagaaaatgtttttgtcaagtacaaggcaacc
cttctggatatctacaaaactggggaagctgttgctgagaaagactctgagattaccttc
attaaaaaggtaacctgtactaacgctgagctggtaaaaggaagacagtacttaattatg
ggtaaagaagccctccagataaaatacaatttcagtttcaggtacatctaccctttagat
tccttgacctggattgaatactggcctagagacacaacatgttcatcgtgtcaagcattt
ttagctaatttagatgaatttgccgaagatatctttttaaatggatgctaa

KEGG   Homo sapiens (human): 729
Entry
729               CDS       T01001                                 

Gene name
C6
Definition
(RefSeq) complement C6
  KO
K03995  complement component 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    729 (C6)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    729 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    729 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a Kazal_3
Other DBs
NCBI-GeneID: 729
NCBI-ProteinID: NP_000056
OMIM: 217050
HGNC: 1339
Ensembl: ENSG00000039537
Vega: OTTHUMG00000094781
Pharos: P13671(Tbio)
UniProt: P13671
LinkDB
Structure
PDB: 
3T5O 4A5W 4E0S 6H04

Position
5p13.1
AA seq 934 aa
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggccagacgctctgtcttgtacttcatcctgctgaatgctctgatcaacaagggccaa
gcctgcttctgtgatcactatgcatggactcagtggaccagctgctcaaaaacttgcaat
tctggaacccagagcagacacagacaaatagtagtagataagtactaccaggaaaacttt
tgtgaacagatttgcagcaagcaggagactagagaatgtaactggcaaagatgccccatc
aactgcctcctgggagattttggaccatggtcagactgtgacccttgtattgaaaaacag
tctaaagttagatctgtcttgcgtcccagtcagtttgggggacagccatgcactgcgcct
ctggtagcctttcaaccatgcattccatctaagctctgcaaaattgaagaggctgactgc
aagaataaatttcgctgtgacagtggccgctgcattgccagaaagttagaatgcaatgga
gaaaatgactgtggagacaattcagatgaaagggactgtgggaggacaaaggcagtatgc
acacggaagtataatcccatccctagtgtacagttgatgggcaatgggtttcattttctg
gcaggagagcccagaggagaagtccttgataactctttcactggaggaatatgtaaaact
gtcaaaagcagtaggacaagtaatccataccgtgttccggccaatctggaaaatgtcggc
tttgaggtacaaactgcagaagatgacttgaaaacagatttctacaaggatttaacttct
cttggacacaatgaaaatcaacaaggctcattctcaagtcagggggggagctctttcagt
gtaccaattttttattcctcaaagagaagtgaaaatatcaaccataattctgccttcaaa
caagccattcaagcctctcacaaaaaggattctagttttattaggatccataaagtgatg
aaagtcttaaacttcacaacgaaagctaaagatctgcacctttctgatgtctttttgaaa
gcacttaaccatctgcctctagaatacaactctgctttgtacagccgaatattcgatgac
tttgggactcattacttcacctctggctccctgggaggcgtgtatgaccttctctatcag
tttagcagtgaggaactaaagaactcaggtttaaccgaggaagaagccaaacactgtgtc
aggattgaaacaaagaaacgcgttttatttgctaagaaaacaaaagtggaacataggtgc
accaccaacaagctgtcagagaaacatgaaggttcatttatacagggagcagagaaatcc
atatccctgattcgaggtggaaggagtgaatatggagcagctttggcatgggagaaaggg
agctctggtctggaggagaagacattttctgagtggttagaatcagtgaaggaaaatcct
gctgtgattgactttgagcttgcccccatcgtggacttggtaagaaacatcccctgtgca
gtgacaaaacggaacaacctcaggaaagctttgcaagagtatgcagccaagttcgatcct
tgccagtgtgctccatgccctaataatggccgacccaccctctcagggactgaatgtctg
tgtgtgtgtcagagtggcacctatggtgagaactgtgagaaacagtctccagattataaa
tccaatgcagtagacggacagtggggttgttggtcttcctggagtacctgtgatgctact
tataagagatcgagaacccgagaatgcaataatcctgccccccaacgaggagggaaacgc
tgtgagggggagaagcgacaagaggaagactgcacattttcaatcatggaaaacaatgga
caaccatgtatcaatgatgacgaagaaatgaaagaggtcgatcttcctgagatagaagca
gattccgggtgtcctcagccagttcctccagaaaatggatttatccggaatgaaaagcaa
ctatacttggttggagaagatgttgaaatttcatgccttactggctttgaaactgttgga
taccagtacttcagatgcttaccagacgggacctggagacaaggggatgtggaatgccaa
cggacggagtgcatcaagccagttgtgcaggaagtcctgacaattacaccatttcagaga
ttgtatagaattggtgaatccattgagctaacttgccccaaaggctttgttgttgctggg
ccatcaaggtacacatgccaggggaattcctggacaccacccatttcaaactctctcacc
tgtgaaaaagatactctaacaaaattaaaaggccattgtcagctgggacagaaacaatca
ggatctgaatgcatttgtatgtctccagaagaagactgtagccatcattcagaagatctc
tgtgtgtttgacacagactccaacgattactttacttcacccgcttgtaagtttttggct
gagaaatgtttaaataatcagcaactccattttctacatattggttcctgccaagacggc
cgccagttagaatggggtcttgaaaggacaagactttcatccaacagcacaaagaaagaa
tcctgtggctatgacacctgctatgactgggaaaaatgttcagcctccacttccaaatgt
gtctgcctattgcccccacagtgcttcaagggtggaaaccaactctactgtgtcaaaatg
ggatcatcaacaagtgagaaaacattgaacatctgtgaagtgggaactataagatgtgca
aacaggaagatggaaatactgcatcctggaaagtgtttggcctag

KEGG   Homo sapiens (human): 730
Entry
730               CDS       T01001                                 

Gene name
C7
Definition
(RefSeq) complement C7
  KO
K03996  complement component 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    730 (C7)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    730 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    730 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi TSP_1 Ldl_recept_a
Other DBs
NCBI-GeneID: 730
NCBI-ProteinID: NP_000578
OMIM: 217070
HGNC: 1346
Ensembl: ENSG00000112936
Vega: OTTHUMG00000150340
Pharos: P10643(Tbio)
UniProt: P10643 Q05CI3
LinkDB
Structure
PDB: 
6H04 2WCY

Position
5p13.1
AA seq 843 aa
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgaaggtgataagcttattcattttggtgggatttataggagagttccaaagtttttca
agtgcctcctctccagtcaactgccagtgggacttctatgccccttggtcagaatgcaat
ggctgtaccaagactcagactcgcaggcggtcagttgctgtgtatgggcagtatggaggc
cagccttgtgttggaaatgcttttgaaacacagtcctgtgaacctacaagaggatgtcca
acagaggagggatgtggagagcgtttcaggtgcttttcaggtcagtgcatcagcaaatca
ttggtttgcaatggggattctgactgtgatgaagacagtgctgatgaagacagatgtgag
gactcagaaaggagaccttcctgtgatatcgataaacctcctcctaacatagaacttact
ggaaatggttacaatgaactcactggccagtttaggaacagagtcatcaataccaaaagt
tttggtggtcaatgtagaaaggtgtttagtggggatggaaaagatttctacaggctgagt
ggaaatgtcctgtcctatacattccaggtgaaaataaataatgattttaattatgaattt
tacaatagtacttggtcttatgtaaaacatacgtcgacagaacacacatcatctagtcgg
aagcgctccttttttagatcttcatcatcttcttcacgcagttatacttcacataccaat
gaaatccataaaggaaagagttaccaactgctggttgttgagaacactgttgaagtggct
cagttcattaataacaatccagaatttttacaacttgctgagccattctggaaggagctt
tcccacctcccctctctgtatgactacagtgcctaccgaagattaatcgaccagtacggg
acacattatctgcaatctgggtcgttaggaggagaatacagagttctattttatgtggac
tcagaaaaattaaaacaaaatgattttaattcagtcgaagaaaagaaatgtaaatcctca
ggttggcattttgtcgttaaattttcaagtcatggatgcaaggaactggaaaacgcttta
aaagctgcttcaggaacccagaacaatgtattgcgaggagaaccgttcatcagaggggga
ggtgcaggcttcatatctggccttagttacctagagctggacaatcctgctggaaacaaa
aggcgatattctgcctgggcagaatctgtgactaatcttcctcaagtcataaaacaaaag
ctgacacctttatatgagctggtaaaggaagtaccttgtgcctctgtgaaaaaactatac
ctgaaatgggctcttgaagagtatctggatgaatttgacccctgtcattgccggccttgt
caaaatggtggtttggctactgttgaggggacccattgtctgtgccattgcaaaccgtac
acatttggtgcggcgtgtgagcaaggagtcctcgtagggaatcaagcaggaggggttgat
ggaggttggagttgctggtcctcttggagcccctgtgtccaagggaagaaaacaagaagc
cgtgaatgcaataacccacctcccagtgggggtgggagatcctgcgttggagaaacgaca
gaaagcacacaatgcgaagatgaggagctggagcacttgaggttgcttgaaccacattgc
tttcctttgtctttggttccaacagaattctgtccatcacctcctgccttgaaagatgga
tttgttcaagatgaaggtacaatgtttcctgtggggaaaaatgtagtgtacacttgcaat
gaaggatactctcttattggaaacccagtggccagatgtggagaagatttacggtggctt
gttggggaaatgcattgtcagaaaattgcctgtgttctacctgtactgatggatggcata
cagagtcacccccaaaaacctttctacacagttggtgagaaggtgactgtttcctgttca
ggtggcatgtccttagaaggtccttcagcatttctctgtggctccagccttaagtggagt
cctgagatgaagaatgcccgctgtgtacaaaaagaaaatccgttaacacaggcagtgcct
aaatgtcagcgctgggagaaactgcagaattcaagatgtgtttgtaaaatgccctacgaa
tgtggaccttccttggatgtatgtgctcaagatgagagaagcaaaaggatactgcctctg
acagtttgcaagatgcatgttctccactgtcagggtagaaattacacccttactggtagg
gacagctgtactctgcctgcctcagctgagaaagcttgtggtgcctgcccactgtgggga
aaatgtgatgctgagagcagcaaatgtgtctgccgagaagcatcggagtgcgaggaagaa
gggtttagcatttgtgtggaagtgaacggcaaggagcagacgatgtctgagtgtgaggcg
ggcgctctgagatgcagagggcagagcatctctgtcaccagcataaggccttgtgctgcg
gaaacccagtag

KEGG   Homo sapiens (human): 731
Entry
731               CDS       T01001                                 

Gene name
C8A
Definition
(RefSeq) complement C8 alpha chain
  KO
K03997  complement component 8 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    731 (C8A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    731 (C8A)
  09164 Neurodegenerative disease
   05020 Prion disease
    731 (C8A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    731 (C8A)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 731
NCBI-ProteinID: NP_000553
OMIM: 120950
HGNC: 1352
Ensembl: ENSG00000157131
Vega: OTTHUMG00000008306
Pharos: P07357(Tbio)
UniProt: P07357
LinkDB
Structure
PDB: 
2RD7 2QQH 3OJY 6H04

Position
1p32.2
AA seq 584 aa
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgtttgctgttgttttcttcatcttgtctttgatgacttgtcagcctggggtaactgca
caggagaaggtgaaccagagagtaagacgggcagctacacccgcagcagttacctgccag
ctgagcaactggtcagagtggacagattgctttccgtgccaggacaaaaagtaccgacac
cggagcctcttgcagccaaacaagtttgggggaaccatctgcagtggtgacatctgggat
caagccagctgctccagttctacaacttgtgtaaggcaagcacagtgtggacaggatttc
cagtgtaaggagacaggtcgctgcctgaaacgccaccttgtgtgtaatggagaccaggac
tgccttgatggctctgatgaggacgactgtgaagatgtcagggccattgacgaagactgc
agccagtatgaaccaattccaggatcacagaaggcagccttggggtacaatatcctgacc
caggaagatgctcagagtgtgtacgatgccagttattatgggggccagtgtgagacggta
tacaatggggaatggagggagcttcgatatgactccacctgtgaacgtctctactatgga
gatgatgagaaatactttcggaaaccctacaactttctgaagtaccactttgaagccctg
gcagatactggaatctcctcagagttttatgataatgcaaatgaccttctttccaaagtt
aaaaaagacaagtctgactcatttggagtgaccatcggcataggcccagccggcagccct
ttattggtgggtgtaggtgtatcccactcacaagacacttcattcttgaacgaattaaac
aagtataatgagaagaaattcattttcacaagaatcttcacaaaggtgcagactgcacat
tttaagatgaggaaggatgacattatgctggatgaaggaatgctgcagtcattaatggag
cttccagatcagtacaattatggcatgtatgccaagttcatcaatgactatggcacccat
tacatcacatctggatccatgggtggcatttatgaatatatcctggtgattgacaaagca
aaaatggaatcccttggtattaccagcagagatatcacgacatgttttggaggctccttg
ggcattcaatatgaagacaaaataaatgttggtggaggtttatcaggagaccattgtaaa
aaatttggaggtggcaaaactgaaagggccaggaaggccatggctgtggaagacattatt
tctcgggtgcgaggtggcagttctggctggagcggtggcttggcacagaacaggagcacc
attacataccgttcctgggggaggtcattaaagtataatcctgttgttatcgattttgag
atgcagcctatccacgaggtgctgcggcacacaagcctggggcctctggaggccaagcgc
cagaacctgcgccgcgccttggaccagtatctgatggaattcaatgcctgccgatgtggg
ccttgcttcaacaatggggtgcccatcctcgagggcaccagctgcaggtgccagtgccgc
ctgggtagcttgggtgctgcctgtgagcaaacacagacagaaggagccaaagcagatggg
agctggagttgctggagctcctggtctgtatgcagagcaggcatccaggaaaggagaaga
gagtgtgacaatccagcacctcagaatggaggggcctcgtgtccagggcggaaagtacag
acgcaggcttgctga

KEGG   Homo sapiens (human): 732
Entry
732               CDS       T01001                                 

Gene name
C8B, C82
Definition
(RefSeq) complement C8 beta chain
  KO
K03998  complement component 8 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    732 (C8B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    732 (C8B)
  09164 Neurodegenerative disease
   05020 Prion disease
    732 (C8B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    732 (C8B)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 732
NCBI-ProteinID: NP_000057
OMIM: 120960
HGNC: 1353
Ensembl: ENSG00000021852
Vega: OTTHUMG00000008305
Pharos: P07358(Tbio)
UniProt: P07358
LinkDB
Structure
PDB: 
3OJY 6H04

Position
1p32.2
AA seq 591 aa
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgaagaattccaggacatgggcttggagggcgccggtggagctatttcttctctgtgct
gccctgggctgtctcagtttgcctggctccagaggtgaaaggccacattcctttgggtca
aatgcagtcaacaagagctttgctaagagcagacagatgcggagtgtggatgttaccctg
atgcccattgattgtgagctgtctagttggtcctcttggaccacatgtgacccctgtcag
aagaaaaggtacaggtatgcctacttgctccagccctctcagttccatggggaaccgtgc
aacttctctgacaaggaagtcgaagactgtgttaccaacagaccatgcggaagtcaagtg
cgatgtgaaggctttgtgtgtgcacagacaggaaggtgtgtaaaccgcagacttctttgc
aatggggacaatgactgtggagaccagtcagatgaagcaaactgtagaaggatttataaa
aaatgtcagcatgaaatggaccaatactggggaattggcagtctggccagtgggataaat
ttgttcacaaacagttttgagggcccagttcttgatcacaggtattatgcaggtggatgc
tccccgcattacatcctgaacacgaggtttaggaagccctacaatgtggaaagctacacg
ccacagacccaaggcaaatacgaattcatattaaaagagtatgaatcatactcagatttt
gaacgcaatgtcacagagaaaatggcaagcaagtctggtttcagttttggttttaaaata
cctggaatatttgaacttggcatcagtagtcaaagtgatcgaggcaaacactatattagg
agaaccaaacgattctctcatactaaaagcgtatttctgcatgcacgctctgaccttgaa
gtagcacattacaagctgaaacccagaagcctcatgctccattacgagttccttcagaga
gttaagcggctgcccctggagtacagctacggggaatacagagatctcttccgtgatttt
gggacccactacatcacagaggctgtgcttgggggcatttatgaatacaccctcgttatg
aacaaagaggccatggagagaggagattatactcttaacaacgtccatgcctgtgccaaa
aatgattttaaaattggtggtgccattgaagaggtctacgtcagtctgggtgtgtctgta
ggcaaatgcagaggtattctgaatgaaataaaagacagaaacaagagggacaccatggtg
gaggacttggtggtcctggtacgaggaggggcaagtgagcacatcaccaccctggcatac
caggagctgccgacggcggacctgatgcaggagtggggagacgctgtgcagtacaaccca
gccatcatcaaagttaaggtggagcctctgtatgaactagtgacagccacagattttgcc
tattccagcacagtgaggcagaacatgaagcaggcactggaggagttccagaaggaagtt
agttcctgccactgtgctccctgccaaggaaatggagtccctgtcctgaaaggatcacgc
tgtgactgcatctgtcctgttggatcccaaggcctagcctgtgaggtctcctatcggaag
aatacccccattgatgggaagtggaattgctggtcaaattggtcttcatgctctggaaga
cgtaagacaagacaaaggcagtgtaacaatccacctcctcaaaatgggggtagcccctgt
tcaggccctgcttcagaaacacttgactgctcctag

KEGG   Homo sapiens (human): 733
Entry
733               CDS       T01001                                 

Gene name
C8G, C8C
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    733 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    733 (C8G)
  09164 Neurodegenerative disease
   05020 Prion disease
    733 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    733 (C8G)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 733
NCBI-ProteinID: NP_000597
OMIM: 120930
HGNC: 1354
Ensembl: ENSG00000176919
Vega: OTTHUMG00000020955
Pharos: P07360(Tbio)
UniProt: P07360
LinkDB
Structure
PDB: 

Position
9q34.3
AA seq 202 aa
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctgccccctgggactgcgaccctcttgactctgctcctggcagctggctcgctgggc
cagaagcctcagaggccacgccggcccgcatcccccatcagcaccatccagcccaaggcc
aattttgatgctcagcagtttgcagggacctggctccttgtggctgtgggctccgcttgc
cgtttcctgcaggagcagggccaccgggccgaggccaccacactgcatgtggctccccag
ggcacagccatggctgtcagtaccttccgaaagctggatgggatctgctggcaggtgcgc
cagctctatggagacacaggggtcctcggccgcttcctgcttcaagcccgagacgcccga
ggggctgtgcacgtggttgtcgctgagaccgactaccagagtttcgctgtcctgtacctg
gagcgggcggggcagctgtcagtgaagctctacgcccgctcgctccctgtgagcgactcg
gtcctgagtgggtttgagcagcgggtccaggaggcccacctgactgaggaccagatcttc
tacttccccaagtacggcttctgcgaggctgcagaccagttccacgtcctggacgaagtg
aggaggtga

KEGG   Homo sapiens (human): 735
Entry
735               CDS       T01001                                 

Gene name
C9, ARMD15, C9D
Definition
(RefSeq) complement C9
  KO
K04000  complement component 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    735 (C9)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    735 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    735 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    735 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1 eIF-5_eIF-2B
Other DBs
NCBI-GeneID: 735
NCBI-ProteinID: NP_001728
OMIM: 120940
HGNC: 1358
Ensembl: ENSG00000113600
Vega: OTTHUMG00000094767
Pharos: P02748(Tbio)
UniProt: P02748
LinkDB
Structure
PDB: 
6DLW 6H04 5FMW

Position
5p13.1
AA seq 559 aa
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtcagcctgccggagctttgcagttgcaatctgcattttagaaataagcatcctcaca
gcacagtacacgaccagttatgacccagagctaacagaaagcagtggctctgcatcacac
atagactgcagaatgagcccctggagtgaatggtcacaatgcgatccttgtctcagacaa
atgtttcgttcaagaagcattgaggtctttggacaatttaatgggaaaagatgcaccgac
gctgtgggagacagacgacagtgtgtgcccacagagccctgtgaggatgctgaggatgac
tgcggaaatgactttcaatgcagtacaggcagatgcataaagatgcgacttcggtgtaat
ggtgacaatgactgcggagacttttcagatgaggatgattgtgaaagtgagccccgtccc
ccctgcagagacagagtggtagaagagtctgagctggcacgaacagcaggctatgggatc
aacattttagggatggatcccctaagcacaccttttgacaatgagttctacaatggactc
tgtaaccgggatcgggatggaaacactctgacatactaccgaagaccttggaacgtggct
tctttgatctatgaaaccaaaggcgagaaaaatttcagaaccgaacattacgaagaacaa
attgaagcatttaaaagtatcatccaagagaagacatcaaattttaatgcagctatatct
ctaaaatttacacccactgaaacaaataaagctgaacaatgttgtgaggaaacagcctcc
tcaatttctttacatggcaagggtagttttcggttttcatattccaaaaatgaaacttac
caactatttttgtcatattcttcaaagaaggaaaaaatgtttctgcatgtgaaaggagaa
attcatctgggaagatttgtaatgagaaatcgcgatgttgtgctcacaacaacttttgtg
gatgatataaaagctttgccaactacctatgaaaagggagaatattttgcctttttggaa
acctatggaactcactacagtagctctgggtctctaggaggactctatgaactaatatat
gttttggataaagcttccatgaagcggaaaggtgttgaactaaaagacataaagagatgc
cttgggtatcatctggatgtatctctggctttctctgaaatctctgttggagctgaattt
aataaagatgattgtgtaaagaggggagagggtagagctgtaaacatcaccagtgaaaac
ctcatagatgatgttgtttcactcataagaggtggaaccagaaaatatgcatttgaactg
aaagaaaagcttctccgaggaaccgtgattgatgtgactgactttgtcaactgggcctct
tccataaatgatgctcctgttctcattagtcaaaaactgtctcctatatataatctggtt
ccagtgaaaatgaaaaatgcacacctaaagaaacaaaacttggaaagagccattgaagac
tatatcaatgaatttagtgtaagaaaatgccacacatgccaaaatggaggtacagtgatt
ctaatggatggaaagtgtttgtgtgcctgcccattcaaatttgagggaattgcctgtgaa
atcagtaaacaaaaaatttctgaaggattgccagccctagagttccccaatgaaaaatag

DBGET integrated database retrieval system