KEGG   Homo sapiens (human): 940
Entry
940               CDS       T01001                                 

Gene name
CD28, Tp44
Definition
(RefSeq) CD28 molecule
  KO
K06470  CD28 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05162  Measles
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06114  PI3K signaling (viruses)
nt06169  Measles virus (MV)
  Element
N00683  CD80/CD86-CD28-PI3K signaling pathway
Drug target
Reltecimod (DG02994): D11281 D11348
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    940 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    940 (CD28)
   04672 Intestinal immune network for IgA production
    940 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    940 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    940 (CD28)
   05323 Rheumatoid arthritis
    940 (CD28)
   05320 Autoimmune thyroid disease
    940 (CD28)
   05330 Allograft rejection
    940 (CD28)
   05332 Graft-versus-host disease
    940 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    940 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    940 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    940 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    940 (CD28)
CD molecules [BR:hsa04090]
 Proteins
  940 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 940
NCBI-ProteinID: NP_006130
OMIM: 186760
HGNC: 1653
Ensembl: ENSG00000178562
Vega: OTTHUMG00000132878
Pharos: P10747(Tbio)
UniProt: P10747
LinkDB
Structure
PDB: 
1YJD

Position
2q33.2
AA seq 220 aa
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgctcaggctgctcttggctctcaacttattcccttcaattcaagtaacaggaaacaag
attttggtgaagcagtcgcccatgcttgtagcgtacgacaatgcggtcaaccttagctgc
aagtattcctacaatctcttctcaagggagttccgggcatcccttcacaaaggactggat
agtgctgtggaagtctgtgttgtatatgggaattactcccagcagcttcaggtttactca
aaaacggggttcaactgtgatgggaaattgggcaatgaatcagtgacattctacctccag
aatttgtatgttaaccaaacagatatttacttctgcaaaattgaagttatgtatcctcct
ccttacctagacaatgagaagagcaatggaaccattatccatgtgaaagggaaacacctt
tgtccaagtcccctatttcccggaccttctaagcccttttgggtgctggtggtggttggt
ggagtcctggcttgctatagcttgctagtaacagtggcctttattattttctgggtgagg
agtaagaggagcaggctcctgcacagtgactacatgaacatgactccccgccgccccggg
cccacccgcaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcc
tga

DBGET integrated database retrieval system