KEGG   Homo sapiens (human): 10073
Entry
10073             CDS       T01001                                 
Symbol
SNUPN, KPNBL, LGMDR29, RNUT1, Snurportin1
Name
(RefSeq) snurportin-1
  KO
K13151  snurportin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
Network
nt06547  Spliceosome
  Element
N01964  pre U1 snRNP import and U1 snRNP formation
Disease
H00593  Limb-girdle muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    10073 (SNUPN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10073 (SNUPN)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Other proteins involved in snRNP biogenesis
    10073 (SNUPN)
SSDB
Motif
Pfam: SPN1_m3Gcap_bd Snurportin1 IBB
Other DBs
NCBI-GeneID: 10073
NCBI-ProteinID: NP_001036046
OMIM: 607902
HGNC: 14245
UniProt: O95149
Structure
LinkDB
Position
15:complement(75598086..75626461)
AA seq 360 aa
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWI
VVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN
QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPE
SLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD
YAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHSPDHPGCLMEN
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaagagttgagtcaggccctggctagtagcttttctgtgtctcaagatctgaacagc
acagctgccccacacccccgcctatcccagtacaagtccaagtacagttccttggagcag
agtgagcgccgccggaggttactggaactgcagaaatccaagcggctggattatgtgaac
catgccagaagactggctgaagatgactggacagggatggagagtgaggaagaaaataag
aaagatgatgaagaaatggacattgacactgtcaagaagttaccaaaacactatgctaat
caattgatgctttctgagtggttaattgacgttccttcagatttggggcaggaatggatt
gtggtcgtgtgccctgttggaaaaagagcccttatcgtggcctccaggggttctaccagt
gcctacaccaagagtggctactgtgtcaacaggttttcttcacttctgccaggaggcaac
aggcgaaactcaacagcaaaagactacaccattctagattgcatttacaatgaggtaaac
cagacctactacgttctggatgtgatgtgctggcggggacaccctttttatgattgccag
actgatttccgattctactggatgcattcaaagttaccagaagaagaaggactgggagag
aaaaccaagcttaatccttttaaatttgtggggctaaagaacttcccttgcactcccgaa
agcctgtgtgatgtgctatctatggatttcccttttgaggtagatggacttctcttctac
cacaaacagacccactacagccccggaagcactcccttggtgggctggctgcgcccctac
atggtgtcagatgtccttggtgtagctgtgccggctggcccgctgaccaccaagccagac
tatgctgggcaccagctccagcagattatggagcacaagaagagccagaaggaaggcatg
aaggagaaactcacacacaaggcctctgagaatgggcactatgaattggagcacctgtct
actcccaagttgaagggttcttcccatagcccagaccaccctggatgcctcatggagaat
taa

KEGG   DISEASE: Limb-girdle muscular dystrophy
Entry
H00593                      Disease                                
Name
Limb-girdle muscular dystrophy
  Subgroup
Sarcoglycanopathies [DS:H00565]
Limb-girdle muscular dystrophy 1C [DS:H00567]
Calpainopathy [DS:H00592]
Muscular dystrophy-dystroglycanopathy type C [DS:H01959]
Muscular dystrophy, autosomal recessive, with cardiomyopathy and triangular tongue (MDRCMTT)
Muscular dystrophy, autosomal recessive, with rigid spine and distal joint contractures (MRRSDC)
Description
Limb-girdle muscular dystrophy (LGMD) is a heterogeneous group of inherited disorders characterized by progressive muscle weakness that begins from the proximal limb muscles. The disease is not congenital, with the age at onset of symptoms varying from early childhood to late adulthood. The primary distinction is between the autosomal dominant (LGMDD) and the autosomal recessive forms (LGMDR). According to the disease mechanisms, the LGMDs may be grouped as follows: dystrophin-dystroglycan complex defects, membrane defects, enzymatic, sarcomeric, and nuclear lamina.
Category
Nervous system disease; Musculoskeletal disease
Brite
Human diseases in ICD-11 classification [BR:br08403]
 08 Diseases of the nervous system
  Diseases of neuromuscular junction or muscle
   Primary disorders of muscles
    8C70  Muscular dystrophy
     H00593  Limb-girdle muscular dystrophy
Pathway-based classification of diseases [BR:br08402]
 Replication, repair and transcription
  nt06547  Spliceosome
   H00593  Limb-girdle muscular dystrophy
 Cellular processes
  nt06548  Integrin signaling
   H00593  Limb-girdle muscular dystrophy
  nt06535  Efferocytosis
   H00593  Limb-girdle muscular dystrophy
  nt06539  Cytoskeleton in muscle cells
   H00593  Limb-girdle muscular dystrophy
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa04518  Integrin signaling
hsa00514  Other types of O-glycan biosynthesis
hsa04512  ECM-receptor interaction
Network
nt06535 Efferocytosis
nt06539 Cytoskeleton in muscle cells
nt06547 Spliceosome
nt06548 Integrin signaling
Gene
(LGMDD1) DNAJB6 [HSA:10049] [KO:K09512]
(LGMDD2) TNPO3 [HSA:23534] [KO:K15436]
(LGMDD3) HNRNPDL [HSA:9987] [KO:K13044]
(LGMDD4/R1) CAPN3 [HSA:825] [KO:K08573]
(LGMDR2) DYSF [HSA:8291] [KO:K18261]
(LGMDR3) SGCA [HSA:6442] [KO:K12565]
(LGMDR4) SGCB [HSA:6443] [KO:K12566]
(LGMDR5) SGCG [HSA:6445] [KO:K12564]
(LGMDR6) SGCD [HSA:6444] [KO:K12563]
(LGMDR7) TCAP [HSA:8557] [KO:K19879]
(LGMDR8) TRIM32 [HSA:22954] [KO:K10607]
(LGMDR9) FKRP [HSA:79147] [KO:K19873]
(LGMDR10) TTN [HSA:7273] [KO:K12567]
(LGMDR11) POMT1 [HSA:10585] [KO:K00728]
(LGMDR12) ANO5 [HSA:203859] [KO:K19480]
(LGMDR13) FKTN [HSA:2218] [KO:K19872]
(LGMDR14) POMT2 [HSA:29954] [KO:K00728]
(LGMDR15) POMGNT1 [HSA:55624] [KO:K09666]
(LGMDR16) DAG1 [HSA:1605] [KO:K06265]
(LGMDR17) PLEC [HSA:5339] [KO:K10388]
(LGMDR18) TRAPPC11 [HSA:60684] [KO:K20308]
(LGMDR19) GMPPB [HSA:29925] [KO:K00966]
(LGMDR20) CRPPA [HSA:729920] [KO:K21031]
(LGMDR21) POGLUT1 [HSA:56983] [KO:K13667]
(LGMDR23) LAMA2 [HSA:3908] [KO:K05637]
(LGMDR24) POMGNT2 [HSA:84892] [KO:K18207]
(LGMDR25) BVES [HSA:11149] [KO:K21108]
(LGMDR26) POPDC3 [HSA:64208] [KO:K26207]
(LGMDR27) JAG2 [HSA:3714] [KO:K21635]
(LGMDR28) HMGCR [HSA:3156] [KO:K00021]
(LGMDR29) SNUPN [HSA:10073] [KO:K13151]
(MDRCMTT) LIMS2 [HSA:55679] [KO:K23354]
(MRRSDC) TOR1AIP1 [HSA:26092] [KO:K23001]
Other DBs
ICD-11: 8C70.4
MeSH: D049288
OMIM: 603511 608423 609115 618129 253600 253601 608099 604286 253700 601287 601954 254110 607155 608807 609308 611307 611588 613158 613157 613818 613723 615356 615352 616052 617232 618138 618135 616812 618848 616827 620375 620793 619566 617072
Reference
  Authors
Nigro V, Aurino S, Piluso G
  Title
Limb girdle muscular dystrophies: update on genetic diagnosis and therapeutic approaches.
  Journal
Curr Opin Neurol 24:429-36 (2011)
DOI:10.1097/WCO.0b013e32834aa38d
Reference
PMID:22334415 (LGMDD1)
  Authors
Harms MB, Sommerville RB, Allred P, Bell S, Ma D, Cooper P, Lopate G, Pestronk A, Weihl CC, Baloh RH
  Title
Exome sequencing reveals DNAJB6 mutations in dominantly-inherited myopathy.
  Journal
Ann Neurol 71:407-16 (2012)
DOI:10.1002/ana.22683
Reference
PMID:12913210 (LGMDD2)
  Authors
Palenzuela L, Andreu AL, Gamez J, Vila MR, Kunimatsu T, Meseguer A, Cervera C, Fernandez Cadenas I, van der Ven PF, Nygaard TG, Bonilla E, Hirano M
  Title
A novel autosomal dominant limb-girdle muscular dystrophy (LGMD 1F) maps to 7q32.1-32.2.
  Journal
Neurology 61:404-6 (2003)
DOI:10.1212/01.wnl.0000073984.46546.4f
Reference
PMID:24647604 (LGMDD3)
  Authors
Vieira NM, Naslavsky MS, Licinio L, Kok F, Schlesinger D, Vainzof M, Sanchez N, Kitajima JP, Gal L, Cavacana N, Serafini PR, Chuartzman S, Vasquez C, Mimbacas A, Nigro V, Pavanello RC, Schuldiner M, Kunkel LM, Zatz M
  Title
A defect in the RNA-processing protein HNRPDL causes limb-girdle muscular dystrophy 1G (LGMD1G).
  Journal
Hum Mol Genet 23:4103-10 (2014)
DOI:10.1093/hmg/ddu127
Reference
PMID:27259757 (LGMDD4)
  Authors
Vissing J, Barresi R, Witting N, Van Ghelue M, Gammelgaard L, Bindoff LA, Straub V, Lochmuller H, Hudson J, Wahl CM, Arnardottir S, Dahlbom K, Jonsrud C, Duno M
  Title
A heterozygous 21-bp deletion in CAPN3 causes dominantly inherited limb girdle muscular dystrophy.
  Journal
Brain 139:2154-63 (2016)
DOI:10.1093/brain/aww133
Reference
PMID:7720071 (LGMDR1)
  Authors
Richard I, Broux O, Allamand V, Fougerousse F, Chiannilkulchai N, Bourg N, Brenguier L, Devaud C, Pasturaud P, Roudaut C, et al.
  Title
Mutations in the proteolytic enzyme calpain 3 cause limb-girdle muscular dystrophy type 2A.
  Journal
Cell 81:27-40 (1995)
DOI:10.1016/0092-8674(95)90368-2
Reference
PMID:9731527 (LGMDR2)
  Authors
Bashir R, Britton S, Strachan T, Keers S, Vafiadaki E, Lako M, Richard I, Marchand S, Bourg N, Argov Z, Sadeh M, Mahjneh I, Marconi G, Passos-Bueno MR, Moreira Ede S, Zatz M, Beckmann JS, Bushby K
  Title
A gene related to Caenorhabditis elegans spermatogenesis factor fer-1 is mutated in limb-girdle muscular dystrophy type 2B.
  Journal
Nat Genet 20:37-42 (1998)
DOI:10.1038/1689
Reference
PMID:8069911 (LGMDR3)
  Authors
Roberds SL, Leturcq F, Allamand V, Piccolo F, Jeanpierre M, Anderson RD, Lim LE, Lee JC, Tome FM, Romero NB, et al.
  Title
Missense mutations in the adhalin gene linked to autosomal recessive muscular dystrophy.
  Journal
Cell 78:625-33 (1994)
DOI:10.1016/0092-8674(94)90527-4
Reference
PMID:7581448 (LGMDR4)
  Authors
Lim LE, Duclos F, Broux O, Bourg N, Sunada Y, Allamand V, Meyer J, Richard I, Moomaw C, Slaughter C, et al.
  Title
Beta-sarcoglycan: characterization and role in limb-girdle muscular dystrophy linked to 4q12.
  Journal
Nat Genet 11:257-65 (1995)
DOI:10.1038/ng1195-257
Reference
PMID:7481775 (LGMDR5)
  Authors
Noguchi S, McNally EM, Ben Othmane K, Hagiwara Y, Mizuno Y, Yoshida M, Yamamoto H, Bonnemann CG, Gussoni E, Denton PH, Kyriakides T, Middleton L, Hentati F, Ben Hamida M, Nonaka I, Vance JM, Kunkel LM, Ozawa E
  Title
Mutations in the dystrophin-associated protein gamma-sarcoglycan in chromosome 13 muscular dystrophy.
  Journal
Science 270:819-22 (1995)
DOI:10.1126/science.270.5237.819
Reference
PMID:8841194 (LGMDR6)
  Authors
Nigro V, de Sa Moreira E, Piluso G, Vainzof M, Belsito A, Politano L, Puca AA, Passos-Bueno MR, Zatz M
  Title
Autosomal recessive limb-girdle muscular dystrophy, LGMD2F, is caused by a mutation in the delta-sarcoglycan gene.
  Journal
Nat Genet 14:195-8 (1996)
DOI:10.1038/ng1096-195
Reference
PMID:10655062 (LGMDR7)
  Authors
Moreira ES, Wiltshire TJ, Faulkner G, Nilforoushan A, Vainzof M, Suzuki OT, Valle G, Reeves R, Zatz M, Passos-Bueno MR, Jenne DE
  Title
Limb-girdle muscular dystrophy type 2G is caused by mutations in the gene encoding the sarcomeric protein telethonin.
  Journal
Nat Genet 24:163-6 (2000)
DOI:10.1038/72822
Reference
PMID:11822024 (LGMDR8)
  Authors
Frosk P, Weiler T, Nylen E, Sudha T, Greenberg CR, Morgan K, Fujiwara TM, Wrogemann K
  Title
Limb-girdle muscular dystrophy type 2H associated with mutation in TRIM32, a putative E3-ubiquitin-ligase gene.
  Journal
Am J Hum Genet 70:663-72 (2002)
DOI:10.1086/339083
Reference
PMID:11592034 (LGMDR9)
  Authors
Brockington M, Blake DJ, Prandini P, Brown SC, Torelli S, Benson MA, Ponting CP, Estournet B, Romero NB, Mercuri E, Voit T, Sewry CA, Guicheney P, Muntoni F
  Title
Mutations in the fukutin-related protein gene (FKRP) cause a form of congenital muscular dystrophy with secondary laminin alpha2 deficiency and abnormal glycosylation of alpha-dystroglycan.
  Journal
Am J Hum Genet 69:1198-209 (2001)
DOI:10.1086/324412
Reference
PMID:12145747 (LGMDR10)
  Authors
Hackman P, Vihola A, Haravuori H, Marchand S, Sarparanta J, De Seze J, Labeit S, Witt C, Peltonen L, Richard I, Udd B
  Title
Tibial muscular dystrophy is a titinopathy caused by mutations in TTN, the gene encoding the giant skeletal-muscle protein titin.
  Journal
Am J Hum Genet 71:492-500 (2002)
DOI:10.1086/342380
Reference
PMID:15792865 (LGMDR11)
  Authors
Balci B, Uyanik G, Dincer P, Gross C, Willer T, Talim B, Haliloglu G, Kale G, Hehr U, Winkler J, Topaloglu H
  Title
An autosomal recessive limb girdle muscular dystrophy (LGMD2) with mild mental retardation is allelic to Walker-Warburg syndrome (WWS) caused by a mutation in the POMT1 gene.
  Journal
Neuromuscul Disord 15:271-5 (2005)
DOI:10.1016/j.nmd.2005.01.013
Reference
PMID:20096397 (LGMDR12)
  Authors
Bolduc V, Marlow G, Boycott KM, Saleki K, Inoue H, Kroon J, Itakura M, Robitaille Y, Parent L, Baas F, Mizuta K, Kamata N, Richard I, Linssen WH, Mahjneh I, de Visser M, Bashir R, Brais B
  Title
Recessive mutations in the putative calcium-activated chloride channel Anoctamin 5 cause proximal LGMD2L and distal MMD3 muscular dystrophies.
  Journal
Am J Hum Genet 86:213-21 (2010)
DOI:10.1016/j.ajhg.2009.12.013
Reference
PMID:17044012 (LGMDR13)
  Authors
Godfrey C, Escolar D, Brockington M, Clement EM, Mein R, Jimenez-Mallebrera C, Torelli S, Feng L, Brown SC, Sewry CA, Rutherford M, Shapira Y, Abbs S, Muntoni F
  Title
Fukutin gene mutations in steroid-responsive limb girdle muscular dystrophy.
  Journal
Ann Neurol 60:603-10 (2006)
DOI:10.1002/ana.21006
Reference
PMID:17878207 (LGMDR14)
  Authors
Godfrey C, Clement E, Mein R, Brockington M, Smith J, Talim B, Straub V, Robb S, Quinlivan R, Feng L, Jimenez-Mallebrera C, Mercuri E, Manzur AY, Kinali M, Torelli S, Brown SC, Sewry CA, Bushby K, Topaloglu H, North K, Abbs S, Muntoni F
  Title
Refining genotype phenotype correlations in muscular dystrophies with defective glycosylation of dystroglycan.
  Journal
Brain 130:2725-35 (2007)
DOI:10.1093/brain/awm212
Reference
PMID:18195152 (LGMDR15)
  Authors
Clement EM, Godfrey C, Tan J, Brockington M, Torelli S, Feng L, Brown SC, Jimenez-Mallebrera C, Sewry CA, Longman C, Mein R, Abbs S, Vajsar J, Schachter H, Muntoni F
  Title
Mild POMGnT1 mutations underlie a novel limb-girdle muscular dystrophy variant.
  Journal
Arch Neurol 65:137-41 (2008)
DOI:10.1001/archneurol.2007.2
Reference
PMID:21388311 (LGMDR16)
  Authors
Hara Y, Balci-Hayta B, Yoshida-Moriguchi T, Kanagawa M, Beltran-Valero de Bernabe D, Gundesli H, Willer T, Satz JS, Crawford RW, Burden SJ, Kunz S, Oldstone MB, Accardi A, Talim B, Muntoni F, Topaloglu H, Dincer P, Campbell KP
  Title
A dystroglycan mutation associated with limb-girdle muscular dystrophy.
  Journal
N Engl J Med 364:939-46 (2011)
DOI:10.1056/NEJMoa1006939
Reference
PMID:21109228 (LGMDR17)
  Authors
Gundesli H, Talim B, Korkusuz P, Balci-Hayta B, Cirak S, Akarsu NA, Topaloglu H, Dincer P
  Title
Mutation in exon 1f of PLEC, leading to disruption of plectin isoform 1f, causes autosomal-recessive limb-girdle muscular dystrophy.
  Journal
Am J Hum Genet 87:834-41 (2010)
DOI:10.1016/j.ajhg.2010.10.017
Reference
PMID:23830518 (LGMDR18)
  Authors
Bogershausen N, Shahrzad N, Chong JX, von Kleist-Retzow JC, Stanga D, Li Y, Bernier FP, Loucks CM, Wirth R, Puffenberger EG, Hegele RA, Schreml J, Lapointe G, Keupp K, Brett CL, Anderson R, Hahn A, Innes AM, Suchowersky O, Mets MB, Nurnberg G, McLeod DR, Thiele H, Waggoner D, Altmuller J, Boycott KM, Schoser B, Nurnberg P, Ober C, Heller R, Parboosingh JS, Wollnik B, Sacher M, Lamont RE
  Title
Recessive TRAPPC11 mutations cause a disease spectrum of limb girdle muscular dystrophy and myopathy with movement disorder and intellectual disability.
  Journal
Am J Hum Genet 93:181-90 (2013)
DOI:10.1016/j.ajhg.2013.05.028
Reference
PMID:23768512 (LGMDR19)
  Authors
Carss KJ, Stevens E, Foley AR, Cirak S, Riemersma M, Torelli S, Hoischen A, Willer T, van Scherpenzeel M, Moore SA, Messina S, Bertini E, Bonnemann CG, Abdenur JE, Grosmann CM, Kesari A, Punetha J, Quinlivan R, Waddell LB, Young HK, Wraige E, Yau S, Brodd L, Feng L, Sewry C, MacArthur DG, North KN, Hoffman E, Stemple DL, Hurles ME, van Bokhoven H, Campbell KP, Lefeber DJ, Lin YY, Muntoni F
  Title
Mutations in GDP-mannose pyrophosphorylase B cause congenital and limb-girdle muscular dystrophies associated with hypoglycosylation of alpha-dystroglycan.
  Journal
Am J Hum Genet 93:29-41 (2013)
DOI:10.1016/j.ajhg.2013.05.009
Reference
PMID:23390185 (LGMDR20)
  Authors
Tasca G, Moro F, Aiello C, Cassandrini D, Fiorillo C, Bertini E, Bruno C, Santorelli FM, Ricci E
  Title
Limb-girdle muscular dystrophy with alpha-dystroglycan deficiency and mutations in the ISPD gene.
  Journal
Neurology 80:963-5 (2013)
DOI:10.1212/WNL.0b013e3182840cbc
Reference
PMID:27807076 (LGMDR21)
  Authors
Servian-Morilla E, Takeuchi H, Lee TV, Clarimon J, Mavillard F, Area-Gomez E, Rivas E, Nieto-Gonzalez JL, Rivero MC, Cabrera-Serrano M, Gomez-Sanchez L, Martinez-Lopez JA, Estrada B, Marquez C, Morgado Y, Suarez-Calvet X, Pita G, Bigot A, Gallardo E, Fernandez-Chacon R, Hirano M, Haltiwanger RS, Jafar-Nejad H, Paradas C
  Title
A POGLUT1 mutation causes a muscular dystrophy with reduced Notch signaling and satellite cell loss.
  Journal
EMBO Mol Med 8:1289-1309 (2016)
DOI:10.15252/emmm.201505815
Reference
PMID:21953594 (LGMDR23)
  Authors
Gavassini BF, Carboni N, Nielsen JE, Danielsen ER, Thomsen C, Svenstrup K, Bello L, Maioli MA, Marrosu G, Ticca AF, Mura M, Marrosu MG, Soraru G, Angelini C, Vissing J, Pegoraro E
  Title
Clinical and molecular characterization of limb-girdle muscular dystrophy due to LAMA2 mutations.
  Journal
Muscle Nerve 44:703-9 (2011)
DOI:10.1002/mus.22132
Reference
PMID:27066570 (LGMDR24)
  Authors
Endo Y, Dong M, Noguchi S, Ogawa M, Hayashi YK, Kuru S, Sugiyama K, Nagai S, Ozasa S, Nonaka I, Nishino I
  Title
Milder forms of muscular dystrophy associated with POMGNT2 mutations.
  Journal
Neurol Genet 1:e33 (2015)
DOI:10.1212/NXG.0000000000000033
Reference
PMID:26642364 (LGMDR25)
  Authors
Schindler RF, Scotton C, Zhang J, Passarelli C, Ortiz-Bonnin B, Simrick S, Schwerte T, Poon KL, Fang M, Rinne S, Froese A, Nikolaev VO, Grunert C, Muller T, Tasca G, Sarathchandra P, Drago F, Dallapiccola B, Rapezzi C, Arbustini E, Di Raimo FR, Neri M, Selvatici R, Gualandi F, Fattori F, Pietrangelo A, Li W, Jiang H, Xu X, Bertini E, Decher N, Wang J, Brand T, Ferlini A
  Title
POPDC1(S201F) causes muscular dystrophy and arrhythmia by affecting protein trafficking.
  Journal
J Clin Invest 126:239-53 (2016)
DOI:10.1172/JCI79562
Reference
PMID:31610034 (LGMDR26)
  Authors
Vissing J, Johnson K, Topf A, Nafissi S, Diaz-Manera J, French VM, Schindler RF, Sarathchandra P, Lokken N, Rinne S, Freund M, Decher N, Muller T, Duno M, Krag T, Brand T, Straub V
  Title
POPDC3 Gene Variants Associate with a New Form of Limb Girdle Muscular Dystrophy.
  Journal
Ann Neurol 86:832-843 (2019)
DOI:10.1002/ana.25620
Reference
PMID:33861953 (LGMDR27)
  Authors
Coppens S, Barnard AM, Puusepp S, Pajusalu S, Ounap K, Vargas-Franco D, Bruels CC, Donkervoort S, Pais L, Chao KR, Goodrich JK, England EM, Weisburd B, Ganesh VS, Gudmundsson S, O'Donnell-Luria A, Nigul M, Ilves P, Mohassel P, Siddique T, Milone M, Nicolau S, Maroofian R, Houlden H, Hanna MG, Quinlivan R, Beiraghi Toosi M, Ghayoor Karimiani E, Costagliola S, Deconinck N, Kadhim H, Macke E, Lanpher BC, Klee EW, Lusakowska A, Kostera-Pruszczyk A, Hahn A, Schrank B, Nishino I, Ogasawara M, El Sherif R, Stojkovic T, Nelson I, Bonne G, Cohen E, Boland-Auge A, Deleuze JF, Meng Y, Topf A, Vilain C, Pacak CA, Rivera-Zengotita ML, Bonnemann CG, Straub V, Handford PA, Draper I, Walter GA, Kang PB
  Title
A form of muscular dystrophy associated with pathogenic variants in JAG2.
  Journal
Am J Hum Genet 108:840-856 (2021)
DOI:10.1016/j.ajhg.2021.03.020
Reference
PMID:36745799 (LGMDR28)
  Authors
Yogev Y, Shorer Z, Koifman A, Wormser O, Drabkin M, Halperin D, Dolgin V, Proskorovski-Ohayon R, Hadar N, Davidov G, Nudelman H, Zarivach R, Shelef I, Perez Y, Birk OS
  Title
Limb girdle muscular disease caused by HMGCR mutation and statin myopathy treatable with mevalonolactone.
  Journal
Proc Natl Acad Sci U S A 120:e2217831120 (2023)
DOI:10.1073/pnas.2217831120
Reference
PMID:38413582 (LGMDR29)
  Authors
Nashabat M, Nabavizadeh N, Saracoglu HP, Saribas B, Avci S, Borklu E, Beillard E, Yilmaz E, Uygur SE, Kayhan CK, Bosco L, Eren ZB, Steindl K, Richter MF, Bademci G, Rauch A, Fattahi Z, Valentino ML, Connolly AM, Bahr A, Viola L, Bergmann AK, Rocha ME, Peart L, Castro-Rojas DL, Bultmann E, Khan S, Giarrana ML, Teleanu RI, Gonzalez JM, Pini A, Schadlich IS, Vill K, Brugger M, Zuchner S, Pinto A, Donkervoort S, Bivona SA, Riza A, Streata I, Glaser D, Baquero-Montoya C, Garcia-Restrepo N, Kotzaeridou U, Brunet T, Epure DA, Bertoli-Avella A, Kariminejad A, Tekin M, von Hardenberg S, Bonnemann CG, Stettner GM, Zanni G, Kayserili H, Oflazer ZP, Escande-Beillard N
  Title
SNUPN deficiency causes a recessive muscular dystrophy due to RNA mis-splicing and ECM dysregulation.
  Journal
Nat Commun 15:1758 (2024)
DOI:10.1038/s41467-024-45933-5
Reference
PMID:25589244 (MDRCMTT)
  Authors
Chardon JW, Smith AC, Woulfe J, Pena E, Rakhra K, Dennie C, Beaulieu C, Huang L, Schwartzentruber J, Hawkins C, Harms MB, Dojeiji S, Zhang M, Majewski J, Bulman DE, Boycott KM, Dyment DA
  Title
LIMS2 mutations are associated with a novel muscular dystrophy, severe cardiomyopathy and triangular tongues.
  Journal
Clin Genet 88:558-64 (2015)
DOI:10.1111/cge.12561
Reference
PMID:24856141 (MRRSDC)
  Authors
Kayman-Kurekci G, Talim B, Korkusuz P, Sayar N, Sarioglu T, Oncel I, Sharafi P, Gundesli H, Balci-Hayta B, Purali N, Serdaroglu-Oflazer P, Topaloglu H, Dincer P
  Title
Mutation in TOR1AIP1 encoding LAP1B in a form of muscular dystrophy: a novel gene related to nuclear envelopathies.
  Journal
Neuromuscul Disord 24:624-33 (2014)
DOI:10.1016/j.nmd.2014.04.007
LinkDB

» Japanese version

DBGET integrated database retrieval system