KEGG   Homo sapiens (human): 10163
Entry
10163             CDS       T01001                                 
Symbol
WASF2, IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
Name
(RefSeq) WASP family member 2
  KO
K05748  WAS protein family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    10163 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10163 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10163 (WASF2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    10163 (WASF2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10163 (WASF2)
   05131 Shigellosis
    10163 (WASF2)
   05135 Yersinia infection
    10163 (WASF2)
   05100 Bacterial invasion of epithelial cells
    10163 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10163 (WASF2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10163 (WASF2)
SSDB
Motif
Pfam: WH2 WASH_WAHD GBR2_CC RasGAP
Other DBs
NCBI-GeneID: 10163
NCBI-ProteinID: NP_008921
OMIM: 605875
HGNC: 12733
Ensembl: ENSG00000158195
Pharos: Q9Y6W5(Tbio)
UniProt: Q9Y6W5
Structure
LinkDB
Position
1:complement(27404230..27490167)
AA seq 498 aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaggttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaagccttc
agaagttccaccattcaagaccagaagctttttgacagaaactctctcccagtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacagg
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatggggcaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccactttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcagttacccagtggacaac
caaagaggatctggtttggctggacccaaaagatccagtgtggtcagcccaagccatcca
ccaccagctcctcctctaggctctccaccaggccctaaacccgggtttgctccaccacct
gcccctccgccacctccgcctccaatgataggcatcccacctccaccaccgcctgtagga
tttgggtctccagggacgcctccaccaccctcacccccatctttcccacctcaccctgat
tttgctgcccctccacctcctcctccaccaccagcagctgactacccaactctgccacca
cctcccttgtcccagccaacaggaggagcacctcctcctccccctcctcctcctcctccg
gggccccctcctccccctttcactggtgcagatggccagcctgctataccaccaccgctt
tctgataccaccaagcccaagtcctccttgcctgccgtgagcgatgcccgtagcgacctg
ctttcagccatccgtcaaggttttcagctgcgcagggttgaggagcagcgggaacaagag
aagcgggatgttgtgggcaatgacgtggccaccatcttgtctcgtcgcattgctgttgag
tacagtgactcagaagatgactcctctgaatttgatgaggacgactggtccgattaa

KEGG   Homo sapiens (human): 10810
Entry
10810             CDS       T01001                                 
Symbol
WASF3, Brush-1, SCAR3, WAVE3
Name
(RefSeq) WASP family member 3
  KO
K06083  WAS protein family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05231  Choline metabolism in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    10810 (WASF3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10810 (WASF3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    10810 (WASF3)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10810 (WASF3)
   05132 Salmonella infection
    10810 (WASF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10810 (WASF3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10810 (WASF3)
SSDB
Motif
Pfam: WH2 Draxin ChaB GBR2_CC
Other DBs
NCBI-GeneID: 10810
NCBI-ProteinID: NP_006637
OMIM: 605068
HGNC: 12734
Ensembl: ENSG00000132970
Pharos: Q9UPY6(Tbio)
UniProt: Q9UPY6 Q5T8P4
LinkDB
Position
13:26539139..26688948
AA seq 502 aa
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcctttagtgaagaggaacattgagccccggcacttgtgccggggagctctgcctgaa
gggattaccagcgaacttgaatgtgtaaccaatagtactcttgccgctatcatacgccag
ctgagcagtctgagcaaacatgctgaagacatatttggtgagttgtttaatgaggctaac
aacttctacatcagagcaaattctcttcaagacagaattgatcgccttgctgtcaaagtc
acccagctggattcaacagtggaagaggtctcactacaggatatcaacatgaaaaaagct
ttcaaaagttccacagtccaagaccagcaagtggtttcaaagaacagcattcctaatcct
gttgctgatatttacaaccagagtgataagccaccgcctctgaacatcctgacaccatac
agagatgacaagaaggatgggctgaagttctatactgatccttcctatttctttgacctc
tggaaagaaaaaatgctacaggacacagaagacaaaaggaaagagaaaaggcgtcaaaag
gagcaaaagcgtatagatggcaccacccgtgaggtgaaaaaggttagaaaagccagaaac
aggcgccaggagtggaatatgatggcatatgacaaagagcttagacccgacaacaggttg
tctcagagtgtgtaccatggagcgtcttccgagggatccctgtccccagatactaggtca
catgcatcggacgttacggattactcttacccggctactcccaaccattctctgcacccc
cagcctgtgaccccttcctatgcagctggtgacgtgccaccacacgggcctgcaagccag
gctgcggagcatgagtaccggcccccatctgcctcggcgaggcacatggccctcaacaga
cctcagcagccgccccccccgcctccccctcaggccccagaggggtcccaggcctctgca
ccgatggctccagcagactacgggatgctcccagcgcagataattgagtattacaaccca
tccggaccacctcctccgccacctcctcctgtgattccctcagcacaaactgccttcgtc
agccctctccagatgcccatgcagcccccgttccctgcatcagccagctccacgcacgca
gctcctcctcacccaccctccaccgggctcctggtcacagccccgccacccccgggccca
ccacctcccccgccaggccctcctggtcccgggtcttctctttcgtcctccccaatgcat
ggccccccagtagctgaggcgaagcggcaagagcctgcacagccaccaatcagtgatgct
cgaagcgacctcctcgctgctattcgaatgggaattcaactgaaaaaggtgcaggagcag
cgggagcaggaggccaagcgggagccagtggggaatgacgtggccacgatcctgtcccgg
cgcattgccgtggagtacagcgactctgacgacgactcagagttcgacgagaacgactgg
tccgactga

KEGG   Homo sapiens (human): 8936
Entry
8936              CDS       T01001                                 
Symbol
WASF1, NEDALVS, SCAR1, WAVE, WAVE1
Name
(RefSeq) WASP family member 1
  KO
K05753  WAS protein family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05231  Choline metabolism in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Disease
H02459  Syndromic neurodevelopmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    8936 (WASF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8936 (WASF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8936 (WASF1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8936 (WASF1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8936 (WASF1)
   05131 Shigellosis
    8936 (WASF1)
   05100 Bacterial invasion of epithelial cells
    8936 (WASF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8936 (WASF1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     8936 (WASF1)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 8936
NCBI-ProteinID: NP_001020105
OMIM: 605035
HGNC: 12732
Ensembl: ENSG00000112290
Pharos: Q92558(Tbio)
UniProt: Q92558
Structure
LinkDB
Position
6:complement(110099819..110179670)
AA seq 559 aa
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ
TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSA
TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPA
TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIP
ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
VEYSDSEDDSEFDEVDWLE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccgctagtgaaaagaaacatcgatcctaggcacttgtgccacacagcactgcctaga
ggcattaagaatgaactggaatgtgtaaccaatatttccttggcaaatataattagacaa
ctaagtagcctaagtaaatatgctgaagatatatttggagaattattcaatgaagcacat
agtttttccttcagagtcaactcattgcaagaacgtgtggaccgtttatctgttagtgtt
acacagcttgatccaaaggaagaagaattgtctttgcaagatataacaatgaggaaagct
ttccgaagttctacaattcaagaccagcagcttttcgatcgcaagactttgcctattcca
ttacaggagacgtacgatgtttgtgaacagcctccacctctcaatatactcactccttat
agagatgatggtaaagaaggtctgaagttttataccaatccttcgtatttctttgatcta
tggaaagaaaaaatgttgcaagatacagaggataagaggaaggaaaagaggaagcagaag
cagaaaaatctagatcgtcctcatgaaccagaaaaagtgccaagagcacctcatgacagg
cggcgagaatggcagaagctggcccaaggtccagagctggctgaagatgatgctaatctc
ttacataagcatattgaagttgctaatggcccagcctctcattttgaaacaagacctcag
acatacgtggatcatatggatggatcttactcactttctgccttgccatttagtcagatg
agtgagcttctgactagagctgaggaaagggtattagtcagaccacatgaaccacctcca
cctccaccaatgcatggagcaggagatgcaaaaccgatacccacctgtatcagttctgct
acaggtttgatagaaaatcgccctcagtcaccagctacaggcagaacacctgtgtttgtg
agccccactcccccacctcctccaccacctcttccatctgccttgtcaacttcctcatta
agagcttcaatgacttcaactcctccccctccagtacctcccccacctccacctccagcc
actgctttgcaagctccagcagtaccaccacctccagctcctcttcagattgcccctgga
gttcttcacccagctcctcctccaattgcacctcctctagtacagccctctccaccagta
gctagagctgccccagtatgtgagactgtaccagttcatccactcccacaaggtgaagtt
caggggctgcctccacccccaccaccgcctcctctgcctccacctggcattcgaccatca
tcacctgtcacagttacagctcttgctcatcctccctctgggctacatccaactccatct
actgccccaggtccccatgttccattaatgcctccatctcctccatcacaagttatacct
gcttctgagccaaagcgccatccatcaaccctacctgtaatcagtgatgccaggagtgtg
ctactggaagcaatacgaaaaggtattcagctacgcaaagtagaagagcagcgtgaacag
gaagctaagcatgaacgcattgaaaacgatgttgccaccatcctgtctcgccgtattgct
gttgaatatagtgattcggaagatgattcagaatttgatgaagtagattggttggagtaa

KEGG   Homo sapiens (human): 10006
Entry
10006             CDS       T01001                                 
Symbol
ABI1, ABI-1, ABLBP4, E3B1, NAP1BP, SSH3BP, SSH3BP1
Name
(RefSeq) abl interactor 1
  KO
K23649  abl interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10006 (ABI1)
   05132 Salmonella infection
    10006 (ABI1)
SSDB
Motif
Pfam: Abi_HHR SH3_1 SH3_9 SH3_2 ATP-synt_ab_Xtn GP3_package
Other DBs
NCBI-GeneID: 10006
NCBI-ProteinID: NP_005461
OMIM: 603050
HGNC: 11320
Ensembl: ENSG00000136754
Pharos: Q8IZP0(Tbio)
UniProt: Q8IZP0
LinkDB
Position
10:complement(26746596..26860958)
AA seq 508 aa
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPPPSGAPPAPPLAPLLPVSTVI
AAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSI
SIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVD
YEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKND
DGWYEGVCNRVTGLFPGNYVESIMHYTD
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcagagctgcagatgttactagaggaggagatcccgtctggcaagagggcgctgatc
gagagttaccagaacctgactcgggtggcagactactgtgaaaacaactacatacaggct
acagacaagagaaaagctttagaggagaccaaagcctatacaacccaatctctagctagt
gttgcttatcaaataaatgcattggccaacaatgtactccagttgctggatatccaagcc
tctcagcttcggagaatggagtcttccatcaatcatatctcacagactgtggatattcat
aaggagaaagtggcacgaagagagattggtattttgacaacaaataagaatacatcaaga
actcacaaaataatagcacctgcgaatatggagcgccctgtaaggtatattcggaaacct
atcgattacacagttctggatgatgtgggccatggtgtcaagtggctaaaagccaagcat
ggaaataaccagcctgcaagaactggcacactgtcgagaacaaatcctcctactcagaaa
ccgccaagtcctcccatgtcaggccggggaacactgggacggaatactccttataaaacc
ctggaacctgttaaacccccaacagttcctaatgactatatgaccagtcctgctaggctt
ggaagtcagcatagtccaggcaggacagcatctttaaatcagagaccaaggacacacagt
ggaagtagtggaggaagtggaagtcgagaaaacagtggtagcagtagtattggcattccc
attgctgtgcctacaccttcgccacccactattggaccagaaaacatttctgtccctcct
ccttctggagctccaccagcaccacctctggcaccacttctcccagtgagcactgtgata
gcagccccgggctcagctcctggttcccagtatggcacaatgaccaggcagatatctcga
cacaactctactacttcttcgacatcttctggtggatacagacgaactccctctgtgact
gctcaattttctgctcagcctcatgttaatggaggtccactttattctcaaaattcaatt
tctattgctccaccccctccccctatgcctcagttgactccacagatacctctcacaggc
ttcgtggccagggtgcaggaaaacattgctgatagtccaactccaccgccaccacctcca
ccagatgacattcccatgtttgatgactctccacctcccccaccaccaccaccagtggat
tatgaagatgaggaggctgcagtagttcagtataatgatccatatgcagatggggatcct
gcttgggcccccaagaattatattgagaaagttgttgcaatatatgattatacaaaagac
aaggatgatgagctgtcatttatggagggtgcaatcatttatgttataaagaagaatgat
gatggctggtatgaaggagtctgcaatcgagtgactggtctgttccctgggaactatgtt
gaatcaatcatgcactatactgattaa

KEGG   Homo sapiens (human): 55845
Entry
55845             CDS       T01001                                 
Symbol
BRK1, C3orf10, HSPC300, MDS027, hHBrk1
Name
(RefSeq) BRICK1 subunit of SCAR/WAVE actin nucleating complex
  KO
K05752  chromosome 3 open reading frame 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    55845 (BRK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    55845 (BRK1)
   05132 Salmonella infection
    55845 (BRK1)
SSDB
Motif
Pfam: CCDC53 MerR-DNA-bind LXG Matrilin_ccoil
Other DBs
NCBI-GeneID: 55845
NCBI-ProteinID: NP_060932
OMIM: 611183
HGNC: 23057
Ensembl: ENSG00000254999
Pharos: Q8WUW1(Tbio)
UniProt: Q8WUW1
Structure
LinkDB
Position
3:10115675..10127190
AA seq 75 aa
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR
IEYIEARVTKGETLT
NT seq 228 nt   +upstreamnt  +downstreamnt
atggcgggacaggaggatccggtgcagcgggagattcaccaggactgggctaaccgggag
tacattgagataatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat
atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga
atagagtacattgaagctcgggtgacaaaaggtgagacactcacctag

KEGG   Homo sapiens (human): 23191
Entry
23191             CDS       T01001                                 
Symbol
CYFIP1, P140SRA-1, SHYC, SRA-1, SRA1
Name
(RefSeq) cytoplasmic FMR1 interacting protein 1
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23191 (CYFIP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23191 (CYFIP1)
   05132 Salmonella infection
    23191 (CYFIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23191 (CYFIP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     23191 (CYFIP1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     23191 (CYFIP1)
SSDB
Motif
Pfam: FragX_IP CYRIA-B_Rac1-bd
Other DBs
NCBI-GeneID: 23191
NCBI-ProteinID: NP_001274739
OMIM: 606322
HGNC: 13759
Ensembl: ENSG00000273749
Pharos: Q7L576(Tbio)
UniProt: Q7L576
Structure
LinkDB
Position
15:complement(22867052..22980898)
AA seq 1253 aa
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVC
DLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggcggcccaggtgactctggaggacgcgctgtccaacgtggacctcctggaggagctg
cccctgcccgaccagcagccctgcatcgagcccccgccatcctcgctgctctaccagcca
aatttcaacactaactttgaagacagaaatgcatttgttactggcatcgcaagatacatt
gaacaagccaccgtccactctagcatgaacgagatgctggaggagggccaagaatatgct
gtcatgctgtacacctggaggagctgctcccgggccatcccacaggtgaaatgtaacgag
cagcctaacagagtggaaatctacgagaaaaccgtggaggttctggagcctgaggtcaca
aaactgatgaatttcatgtacttccagagaaatgccattgagcgtttctgcggggaagtg
aggcgcctgtgccatgccgagaggaggaaggacttcgtgtcagaagcctacctgatcaca
ctgggcaaattcatcaacatgttcgctgtgctggacgagctgaagaacatgaagtgcagt
gtgaagaacgaccactcagcgtacaagagggccgctcagtttttacgtaaaatggcagat
ccacagtccatccaggaatcgcagaatctgtccatgttcctggccaatcataacaagatc
acacagtctctgcagcagcagctcgaagtgatttctggctacgaagagctcctggcagat
attgtgaatctgtgtgtggattactacgagaacaggatgtatttgacgcccagtgagaaa
cacatgcttctcaaagtcatgggatttggtctgtacctgatggatgggagtgtcagtaac
atctataagttggatgccaagaaaagaataaacttatccaaaatcgacaagtacttcaag
caactccaggtggttccgctatttggggacatgcaaatagaactggcaagatatatcaag
accagcgcccactacgaggaaaataaatctcgatggacgtgcacatcctccggcagcagc
cctcagtacaacatctgcgagcagatgatccagatccgcgaggaccacatgcgcttcatt
tcggagctggcgcgctacagcaacagcgaggtggtcacgggctcgggccgccaggaggcc
cagaagacggacgcggagtaccgcaagctcttcgacctggcgctgcagggcctgcagctg
ttgtcgcagtggagcgcgcacgtgatggaagtgtattcctggaagcttgtgcaccccacc
gacaagtactccaacaaggactgccccgacagcgctgaagagtacgagcgtgccacgcgc
tacaactacaccagcgaggagaagtttgccctagtggaggtgatcgccatgatcaaaggc
ctgcaggtgctgatgggcaggatggagagcgtgttcaaccacgccatccggcacaccgtc
tatgccgcactgcaggacttctcccaggtgacccttagggagccgctgcggcaggccatc
aagaagaagaagaacgtcatccagagtgtcctgcaggccatcaggaagaccgtgtgtgac
tgggagacggggcatgagcccttcaatgacccagccttgcggggcgagaaggaccccaag
agcggcttcgacataaaagtaccacgccgcgccgtgggaccctccagcactcagctttac
atggtgagaaccatgctagagtccctcattgcagacaaaagtggttccaagaaaaccttg
agaagtagccttgaggggcccaccatattggacatagaaaaatttcatcgagagtcattc
ttctacactcacttgataaatttcagtgaaacgctgcagcagtgctgtgacctttcgcag
ctgtggttccgagagttcttcctggagctgaccatgggcaggaggatccagttccccatt
gagatgtcgatgccctggatcctgacggaccacatcctggagaccaaggaggcatcgatg
atggagtacgtgctctactccctggacctgtacaatgacagcgcccactacgcgctcacc
aggttcaacaagcagttcctgtacgacgaaattgaggccgaggtgaatctatgttttgac
caatttgtttacaagctagcagaccagatatttgcctattataaggttatggcaggaagt
ttgcttcttgataaacggttacgatcagaatgcaagaatcagggagccacgatccacctc
ccgccgtctaaccgctacgagacgctgctgaagcagaggcatgtgcagctcctcggcaga
tcaatagacctcaatcgtctgatcacccagcgcgtctcagcagccatgtataagtcccta
gaactggcgattggacgatttgaaagtgaagatttgacctccatagttgagctggatggc
ctgttggaaatcaaccgcatgacccacaagctgctgagccggtacctgacgctggacggc
ttcgacgccatgttccgggaggccaaccacaacgtgtcagcgccctacgggaggatcacc
ctgcacgtcttctgggagctcaactatgacttcctgcccaactactgctacaacggctct
accaaccggtttgttcggacagtgttaccattttctcaggaatttcaaagagataagcag
cctaatgcacagcctcagtatctgcatggatccaaggctttgaacttggcctactccagc
atttacggcagctaccggaacttcgtgggacctccacactttcaagtcatctgccggctt
ctcggctaccagggtatcgccgtggtcatggaggagctgctgaaggtcgtcaagagcctg
ctgcaaggcacaatcctgcagtacgtgaagacgctgatggaggtgatgcccaagatctgc
cgcctgccccggcacgagtacggctctcctggtatcctggagttcttccaccaccagctg
aaggacatcgtggagtacgcagagctgaagacggtgtgcttccagaacctgcgggaggtg
gggaacgccatcctcttctgcctgctcatcgagcagagcctgtctttagaagaagtgtgt
gacctgctgcacgcggctcctttccagaacatcttgccgcgagtccatgtgaaagagggg
gagagacttgatgccaaaatgaaaagactagaatcaaagtacgccccgctgcatcttgtc
ccactgattgaaagactggggacccctcagcaaattgccatcgcaagagagggggacctg
ctgacaaaggagcgcctctgctgcggcctgtccatgtttgaggtcatcctgacacggatc
cggagctttctggatgaccccatctggcgcgggcctctgcccagcaatggggtcatgcat
gtggacgagtgtgtggagtttcacagactgtggagtgccatgcagtttgtctactgcatt
cccgtggggacacacgagttcacagtcgagcagtgctttggtgatgggctacactgggct
ggctgtatgatcatcgtacttcttgggcagcagcggcgttttgctgtgctggatttctgc
taccatctacttaaagtccagaaacatgatggcaaagatgagattattaaaaatgtgcct
ttgaagaagatggtggagagaattcgcaagttccagattctcaatgatgagatcatcacc
atcctggataagtacctgaagtcaggcgacggggagggcacgccagtggagcatgtgcgc
tgcttccagccgcccatccaccagtccctcgccagcagctga

KEGG   Homo sapiens (human): 26999
Entry
26999             CDS       T01001                                 
Symbol
CYFIP2, DEE65, EIEE65, PIR121
Name
(RefSeq) cytoplasmic FMR1 interacting protein 2
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    26999 (CYFIP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    26999 (CYFIP2)
   05132 Salmonella infection
    26999 (CYFIP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    26999 (CYFIP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26999 (CYFIP2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     26999 (CYFIP2)
SSDB
Motif
Pfam: FragX_IP CYRIA-B_Rac1-bd zf-CW
Other DBs
NCBI-GeneID: 26999
NCBI-ProteinID: NP_001278651
OMIM: 606323
HGNC: 13760
Ensembl: ENSG00000055163
Pharos: Q96F07(Tbio)
UniProt: Q96F07
LinkDB
Position
5:157266123..157395594
AA seq 1278 aa
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLAD
IVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMVQIRDDHIRFI
SELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIY
AALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKG
GFDIKVPRRAVGPSSTQACQWSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGS
KKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRI
QFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVN
LCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQ
LLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHM
TLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQ
RDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKI
VKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQS
LREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAP
LHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTN
GVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDL
FDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTV
EHVRCFQPPIHQSLATTC
NT seq 3837 nt   +upstreamnt  +downstreamnt
atgaccacgcacgtcaccctggaagatgccctgtccaacgtggacctgcttgaagagctt
cccctccccgaccagcagccatgcatcgagcctccaccttcctccatcatgtaccaggct
aactttgacacaaactttgaggacaggaatgcatttgtcacgggcattgcaaggtacatt
gagcaggctacagtccactccagcatgaatgagatgctggaggaaggacatgagtatgcg
gtcatgctgtacacctggcgcagctgttcccgggccattccccaggtgaaatgcaacgag
cagcccaaccgagtagagatctatgagaagacagtagaggtgctggagccggaggtcacc
aagctcatgaagttcatgtattttcagcgcaaggccatcgagcggttctgcagcgaggtg
aagcggctgtgccatgccgagcgcaggaaggactttgtctctgaggcctacctcctgacc
cttggcaagttcatcaacatgtttgctgtcctggatgagctaaagaacatgaagtgcagc
gtcaagaatgaccactctgcctacaagagggcagcacagttcctgcggaagatggcagat
ccccagtctatccaggagtcgcagaacctttccatgttcctggccaaccacaacaggatc
acccagtgtctccaccagcaacttgaagtgatcccaggctatgaggagctgctggctgac
attgtcaacatctgtgtggattactacgagaacaagatgtacctgactcccagtgagaaa
catatgctcctcaaggtgatgggctttggcctctacctaatggatggaaatgtcagtaac
atttacaaactggatgccaagaagagaattaatcttagcaaaattgataaattctttaag
cagctgcaggtggtgccccttttcggcgacatgcagatagagctggccagatacattaag
accagtgctcactatgaagagaacaagtccaagtggacgtgcacccagagcagcatcagc
ccccagtacaatatctgcgagcagatggttcagatccgggatgaccacatccgcttcatc
tccgagctcgctcgctacagcaacagtgaggtggtgacgggctcagggctggacagccag
aagtcagacgaggagtatcgcgagctcttcgacctagccctgcggggtctgcagcttcta
tccaagtggagcgcccacgtcatggaggtgtactcttggaagctggttcatcccacagac
aagttctgcaacaaggactgtcctggcaccgcggaggaatatgagagagccacacgctac
aattacaccagtgaggaaaaatttgccttcgttgaggtgatcgccatgatcaaaggcctg
caggtgctcatgggcaggatggagagcgtcttcaaccaggccatcaggaacaccatctac
gcggcattgcaggacttcgcccaggtgacgctgcgtgagcccctgcggcaggcggtacgg
aagaagaagaatgtcctcatcagcgtcctacaggcaattcgaaagaccatctgtgactgg
gagggagggcgagagccccctaatgacccatgcttgagaggggagaaggaccccaaaggt
ggatttgatatcaaggtgccccggcgtgctgtggggccatccagcacacaggcctgccag
tggtccccgagggctttgtttcaccccactggtggcacacagggccgaagaggctgccga
tccctgctgtacatggtgcggaccatgcttgaatcactcattgcagacaaaagcggctcc
aagaagaccctgaggagcagcctggatggacccattgtcctcgccatagaggactttcac
aaacagtccttcttcttcacacatctgctcaacatcagtgaagccctgcagcagtgttgt
gacctctcccagctctggttccgagaattcttcctggagttaaccatgggccgacgaatc
cagttccccatcgagatgtccatgccctggattctaacggaccatatcctggaaaccaaa
gaaccttccatgatggagtatgtcctctaccctctggatctgtacaacgacagcgcctac
tatgctctgaccaagtttaaaaagcagttcctgtacgatgagatagaagctgaggtgaac
ctgtgttttgatcagtttgtctacaagctggcagaccagatctttgcttactacaaagcc
atggctggcagtgtcctgttggataaacgttttcgagctgagtgtaagaattatggcgtc
atcattccgtatccaccgtccaatcgctatgaaacactgctgaagcagagacacgtccag
ctgttgggtagatcaattgacttgaacagactcattacccagcgcatctctgccgccatg
tataaatccttggaccaagctatcagccgctttgagagtgaggacctgacctccattgtg
gagctggagtggctgctggagattaaccggctcacgcatcggctgctctgtaagcatatg
acgctggacagcttcgatgccatgttccgagaggccaatcacaatgtgtccgccccctat
ggccgtatcaccctgcatgtcttctgggaactgaactttgactttctccccaactactgc
tacaatgggtccactaaccgttttgtgcggactgccattcctttcacccaagaaccacaa
cgagacaaacctgccaacgtccagccttattacctctatggatccaagcctctcaacatt
gcctacagccacatctacagctcctacaggaatttcgtggggccacctcatttcaagact
atctgcagactcctgggttatcagggcatcgctgtggtcatggaggaactgctaaagatt
gtgaagagcttgctccaaggaaccattctccagtatgtgaaaacactgatagaggtgatg
cccaagatatgccgcttgccccgacatgagtatggctccccagggatcctggagttcttc
caccaccagctgaaggacatcattgagtacgcagagctcaaaacagacgtgttccagagc
ctgagggaagtgggcaatgccatcctcttctgcctcctcatagagcaagctctgtctcag
gaggaggtctgcgatttgctccatgccgcacccttccaaaacatcttgcctagagtctac
atcaaagagggggagcgcctggaggtccggatgaaacgtctggaagccaagtatgccccg
ctccacctggtccctctgatcgagcggctggggacccctcagcaaatcgccattgctcgc
gagggtgacctcctgaccaaggagcggctgtgctgtggcctgtccatgttcgaggtcatc
ctgacccgcattcggagctacctgcaggaccccatctggcggggcccaccgcccaccaat
ggcgtcatgcacgtcgatgagtgtgtggagttccaccggctgtggagcgccatgcagttc
gtgtactgcatccctgtgggaaccaacgagttcacagctgagcagtgtttcggcgatggc
ttgaactgggctggttgctccatcattgtcctgctgggccagcagcgtcgctttgacctg
ttcgacttctgttaccacctgctaaaagtgcagaggcaggacgggaaggatgaaatcatt
aagaatgtgcccctgaagaagatggccgaccggatcaggaagtatcagatcttgaacaat
gaggtttttgccatcctgaacaaatacatgaagtccgtggagacagacagttccactgtg
gagcatgtgcgctgcttccagccacccatccaccagtccttggccaccacttgctaa

KEGG   Homo sapiens (human): 10787
Entry
10787             CDS       T01001                                 
Symbol
NCKAP1, HEM2, NAP1, NAP125, p125Nap1
Name
(RefSeq) NCK associated protein 1
  KO
K05750  NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10787 (NCKAP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10787 (NCKAP1)
   05132 Salmonella infection
    10787 (NCKAP1)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 10787
NCBI-ProteinID: NP_038464
OMIM: 604891
HGNC: 7666
Ensembl: ENSG00000061676
Pharos: Q9Y2A7(Tbio)
UniProt: Q9Y2A7
Structure
LinkDB
Position
2:complement(182909115..183038457)
AA seq 1128 aa
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFI
VRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVF
FDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQ
MIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTML
NPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEV
FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQ
PGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEV
FDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLS
IFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKP
GVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSI
VGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHG
EPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYE
LSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSP
AIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRN
RESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgtcgcgctcagtgctgcagcccagtcagcagaagctggcggagaagctcaccatcctc
aacgaccggggcgtcggcatgctcacccgcctctacaacatcaagaaggcatgtggagac
cccaaggcaaaaccatcctatcttatcgacaaaaacctggaatctgctgtgaaattcata
gtcagaaaattccctgctgtagaaacccgcaacaacaatcaacagcttgcacaactacag
aaagaaaaatcagagattctgaaaaatctggcattatattacttcacatttgtagatgtt
atggaatttaaggaccatgtttgtgaattgctgaatactattgacgtttgccaagtcttc
tttgatattactgtaaactttgatttaacaaagaactacttagatttaattataacctat
acaacactaatgatactgctgtctcgaattgaagaaaggaaggcaatcattggattatac
aactatgcccatgaaatgactcatggagcaagtgacagagaatacccacgccttggccag
atgattgtggattatgaaaaccctttaaagaagatgatggaagaatttgtaccccatagc
aagtctctttcagatgcactaatttctcttcaaatggtatatcctcgaaggaatctttca
gctgaccagtggagaaatgcccagttattgagcctcatcagtgcacctagtacaatgctt
aatccagcacagtccgacactatgccttgtgaatacctctctttggatgcaatggaaaag
tggattatctttggctttattttgtgccatgggatcctaaatactgacgctacagcactg
aacctttggaaactagctcttcaaagtagctcttgcctctctctctttcgggatgaagtt
ttccacattcacaaagctgcagaagacttatttgtaaacatacgaggctataataaacgt
attaatgacataagagaatgcaaggaggcagccgtgtcacatgctggttcaatgcacaga
gaaagacgcaagtttttaagatctgcactgaaggaattggctactgtcctctctgatcaa
cctggattgctaggtcccaaggcactttttgtttttatggcattatcctttgcccgtgat
gaaatcatctggctacttcgtcatgcagataacatgccaaagaagagtgcagacgacttt
atagataagcacattgctgaattaatattttacatggaagaacttagagcacatgtgagg
aaatacggacctgtaatgcagaggtattacgtgcagtacctttctggctttgatgctgtt
gtcctcaatgaactcgtgcagaatctttctgtttgccctgaagatgaatcaatcatcatg
tcctcttttgttaacactatgacttccctaagtgtaaaacaagttgaagatggggaagta
tttgatttcagaggaatgagattagattggtttaggttacaggcatatactagtgtctca
aaggcttcacttggccttgcagatcacagagaacttggaaagatgatgaatacaataatt
tttcatacaaaaatggtagattccttggtggaaatgttggtggaaacatcagatctctcc
atattttgtttttatagtcgtgcttttgagaagatgtttcaacagtgtttggagttaccc
tctcaatcaagatactcaattgcatttccactactttgcactcattttatgagttgcacg
catgaactatgtccagaagagcgacatcatattggagatcgcagtctttccttatgtaat
atgttcctagatgaaatggccaaacaagctcgaaatctcatcactgatatttgcacagaa
cagtgtacccttagtgaccagttgctacccaagcattgtgccaaaactatcagtcaagca
gtgaataagaaatcaaaaaagcagactggtaagaaaggggaacctgaaagggagaaacca
ggtgttgagagcatgaggaaaaacaggctggttgtgaccaaccttgataaattgcacact
gcactttctgagttatgcttctctataaattatgtaccaaacatggtggtatgggaacat
acctttaccccacgagaatatttgacttctcatctggaaatacgctttaccaagtcaatt
gttgggatgactatgtataatcaagccacacaggaaattgcaaaaccttcagaacttcta
acaagtgtaagagcatacatgaccgtactccagtcaatagaaaactatgtgcagattgat
attacaagagtatttaataatgtgcttcttcaacaaacacaacatttagacagtcatgga
gagccaaccattacaagtctatacacaaattggtatttggaaactttgttacgacaagtc
agcaatggccatatagcatattttcctgcaatgaaagcgtttgtgaacttacctacagaa
aatgaattaacattcaatgcagaggaatattctgacatatcagaaatgaggtcattatca
gaactactaggcccatatggtatgaagtttctaagtgaaagccttatgtggcatatttca
tcacaagttgctgaacttaagaaacttgtggtggagaatgttgatgtgttaacacaaatg
aggaccagctttgacaaaccagaccagatggctgcactgtttaaaagattatcatctgtt
gacagtgtcttgaagaggatgacaataattggtgtaattttatccttccgatcattggca
caagaagcacttagagatgtcttatcctaccacattccttttcttgtaagttcaattgaa
gattttaaggatcacattccaagggaaactgatatgaaggttgcaatgaatgtgtatgag
ttatcatcagctgccggattaccttgtgagattgatcctgcattggtcgtagctctttct
tcacaaaaatcggaaaacattagtccagaagaagagtataaaattgcctgccttctcatg
gtgtttgtggcagtttctttgccaacactggccagtaatgtgatgtctcagtacagccct
gctatagaagggcattgcaacaacatacattgcttggccaaagccatcaaccagattgct
gcagctttgtttacaattcacaaaggaagcattgaagaccgtcttaaagaatttctggcg
cttgcatcctccagtctactgaaaattggccaggagacagataaaactacaacaagaaat
agagaatctgtttatttactgctagatatgattgtacaagaatctccattccttacaatg
gatcttttggaatcttgttttccttatgtcttgctgagaaatgcataccatgctgtctac
aaacaaagtgttacatcttctgcataa

DBGET integrated database retrieval system