KEGG   Homo sapiens (human): 10459
Entry
10459             CDS       T01001                                 
Symbol
MAD2L2, FANCV, MAD2B, POLZ2, REV7
Name
(RefSeq) mitotic arrest deficient 2 like 2
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05100  Bacterial invasion of epithelial cells
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00493  Spindle assembly checkpoint signaling
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10459 (MAD2L2)
   04114 Oocyte meiosis
    10459 (MAD2L2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10459 (MAD2L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    10459 (MAD2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10459 (MAD2L2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     10459 (MAD2L2)
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 10459
NCBI-ProteinID: NP_001120797
OMIM: 604094
HGNC: 6764
Ensembl: ENSG00000116670
Vega: OTTHUMG00000002231
Pharos: Q9UI95(Tbio)
UniProt: Q9UI95 A0A024R4I4
Structure
LinkDB
Position
1:complement(11674480..11691830)
AA seq 211 aa
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaccacgctcacacgacaagacctcaactttggccaagtggtggccgatgtgctctgc
gagttcctggaggtggctgtgcatctcatcctctacgtgcgcgaggtctaccccgtgggc
atcttccagaaacgcaagaagtacaacgtgccggtccagatgtcctgccacccggagctg
aatcagtatatccaggacacgctgcactgcgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtgattttggataaagagcaccgcccagtggagaaattcgtcttt
gagatcacccagcctccactgctgtccatcagctcagactcgctgttgtctcatgtggag
cagctgctccgggccttcatcctgaagatcagcgtgtgcgatgccgtcctggaccacaac
cccccaggctgtaccttcacagtcctggtgcacacgagagaagccgccactcgcaacatg
gagaagatccaggtcatcaaggatttcccctggatcctggcggatgagcaggatgtccac
atgcatgacccccggctgataccactaaaaaccatgacgtcggacattttaaagatgcag
ctttacgtggaagagcgcgctcataaaggcagctga

KEGG   Homo sapiens (human): 4085
Entry
4085              CDS       T01001                                 
Symbol
MAD2L1, HSMAD2, MAD2
Name
(RefSeq) mitotic arrest deficient 2 like 1
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4085 (MAD2L1)
   04114 Oocyte meiosis
    4085 (MAD2L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    4085 (MAD2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4085 (MAD2L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4085 (MAD2L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     4085 (MAD2L1)
SSDB
Motif
Pfam: HORMA ATG101 ATG13 bacHORMA_2
Other DBs
NCBI-GeneID: 4085
NCBI-ProteinID: NP_002349
OMIM: 601467
HGNC: 6763
Ensembl: ENSG00000164109
Vega: OTTHUMG00000132967
Pharos: Q13257(Tbio)
UniProt: Q13257
Structure
LinkDB
Position
4:complement(120055623..120066848)
AA seq 205 aa
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgctgcagctctcccgggagcagggaatcaccctgcgcgggagcgccgaaatcgtg
gccgagttcttctcattcggcatcaacagcattttatatcagcgtggcatatatccatct
gaaacctttactcgagtgcagaaatacggactcaccttgcttgtaactactgatcttgag
ctcataaaatacctaaataatgtggtggaacaactgaaagattggttatacaagtgttca
gttcagaaactggttgtagttatctcaaatattgaaagtggtgaggtcctggaaagatgg
cagtttgatattgagtgtgacaagactgcaaaagatgacagtgcacccagagaaaagtct
cagaaagctatccaggatgaaatccgttcagtgatcagacagatcacagctacggtgaca
tttctgccactgttggaagtttcttgttcatttgatctgctgatttatacagacaaagat
ttggttgtacctgaaaaatgggaagagtcgggaccacagtttattaccaattctgaggaa
gtccgccttcgttcatttactactacaatccacaaagtaaatagcatggtggcctacaaa
attcctgtcaatgactga

DBGET integrated database retrieval system