KEGG   Homo sapiens (human): 121278
Entry
121278            CDS       T01001                                 
Symbol
TPH2, ADHD7, NTPH
Name
(RefSeq) tryptophan hydroxylase 2
  KO
K00502  tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
Module
hsa_M00037  Melatonin biosynthesis, animals, tryptophan => serotonin => melatonin
Network
nt06028  Dopamine and serotonin metabolism
  Element
N01551  Serotonin metabolism
Disease
H01646  Major depressive disorder
H01895  Attention deficit hyperactivity disorder (ADHD)
Drug target
Telotristat (DG02809): D09973 D09974 D09975<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    121278 (TPH2)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    121278 (TPH2)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    121278 (TPH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.4  tryptophan 5-monooxygenase
     121278 (TPH2)
SSDB
Motif
Pfam: Biopterin_H ACT
Other DBs
NCBI-GeneID: 121278
NCBI-ProteinID: NP_775489
OMIM: 607478
HGNC: 20692
Ensembl: ENSG00000139287
Pharos: Q8IWU9(Tchem)
UniProt: Q8IWU9
Structure
LinkDB
Position
12:71938845..72032440
AA seq 490 aa
MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATE
SGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFN
ELIQLLKFQTTIVTLNPPENIWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHP
GFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYL
KNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQ
YIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFF
TIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF
VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
LNKMNQYLGI
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcagccagcaatgatgatgttttccagtaaatactgggcacggagagggttttccctg
gattcagcagtgcccgaagagcatcagctacttggcagctcaacactaaataaacctaac
tctggcaaaaatgacgacaaaggcaacaagggaagcagcaaacgtgaagctgctaccgaa
agtggcaagacagcagttgttttctccttgaagaatgaagttggtggattggtaaaagca
ctgaggctctttcaggaaaaacgtgtcaacatggttcatattgaatccaggaaatctcgg
cgaagaagttctgaggttgaaatctttgtggactgtgagtgtgggaaaacagaattcaat
gagctcattcagttgctgaaatttcaaaccactattgtgacgctgaatcctccagagaac
atttggacagaggaagaagagctagaggatgtgccctggttccctcggaagatctctgag
ttagacaaatgctctcacagagttctcatgtatggttctgagcttgatgctgaccaccca
ggatttaaggacaatgtctatcgacagagaagaaagtattttgtggatgtggccatgggt
tataaatatggtcagcccattcccagggtggagtatactgaagaagaaactaaaacttgg
ggtgttgtattccgggagctctccaaactctatcccactcatgcttgccgagagtatttg
aaaaacttccctctgctgactaaatactgtggctacagagaggacaatgtgcctcaactc
gaagatgtctccatgtttctgaaagaaaggtctggcttcacggtgaggccggtggctgga
tacctgagcccacgagactttctggcaggactggcctacagagtgttccactgtacccag
tacatccggcatggctcagatcccctctacaccccagaaccagacacatgccatgaactc
ttgggacatgttccactacttgcggatcctaagtttgctcagttttcacaagaaataggt
ctggcgtctctgggagcatcagatgaagatgttcagaaactagccacgtgctatttcttc
acaatcgagtttggcctttgcaagcaagaagggcaactgcgggcatatggagcaggactc
ctttcctccattggagaattaaagcacgccctttctgacaaggcatgtgtgaaagccttt
gacccaaagacaacttgcttacaggaatgccttatcaccaccttccaggaagcctacttt
gtttcagaaagttttgaagaagccaaagaaaagatgagggactttgcaaagtcaattacc
cgtcccttctcagtatacttcaatccctacacacagagtattgaaattctgaaagacacc
agaagtattgaaaatgtggtgcaggaccttcgcagcgacttgaatacagtgtgtgatgct
ttaaacaaaatgaaccaatatctggggatttga

DBGET integrated database retrieval system