KEGG   Homo sapiens (human): 142
Entry
142               CDS       T01001                                 

Gene name
PARP1, ADPRT, ADPRT_1, ADPRT1, ARTD1, PARP, PARP-1, PPOL, pADPRT-1
Definition
(RefSeq) poly(ADP-ribose) polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa05415  Diabetic cardiomyopathy
Drug target
Iniparib: D09913
Niraparib (DG03120): D10140 D11895<JP/US>
Olaparib: D09730<JP/US>
Pamiparib: D11426
Rucaparib (DG01864): D10079 D10157 D10982<US>
Talazoparib (DG01865): D10732 D10733<US>
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    142 (PARP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    142 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    142 (PARP1)
   04217 Necroptosis
    142 (PARP1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    142 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    142 (PARP1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    142 (PARP1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    142 (PARP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     142 (PARP1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    142 (PARP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    142 (PARP1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     142 (PARP1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2 ESF1
Other DBs
NCBI-GeneID: 142
NCBI-ProteinID: NP_001609
OMIM: 173870
HGNC: 270
Ensembl: ENSG00000143799
Vega: OTTHUMG00000037556
Pharos: P09874(Tclin)
UniProt: P09874 A0A024R3T8
LinkDB
Structure
PDB: 

Position
1q42.12
AA seq 1014 aa
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggagtcttcggataagctctatcgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcgcccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcaccctgacgttgaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggat
ggaattggtagcaaggcagagaagactctgggtgactttgcagcagagtatgccaagtcc
aacagaagtacgtgcaaggggtgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatggtggacccggagaagccacagctaggcatgattgaccgctggtaccatcca
ggctgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctacagaggataaagaagccctgaagaagcagctccca
ggagtcaagagtgaaggaaagagaaaaggcgatgaggtggatggagtggatgaagtggcg
aagaagaaatctaaaaaagaaaaagacaaggatagtaagcttgaaaaagccctaaaggct
cagaacgacctgatctggaacatcaaggacgagctaaagaaagtgtgttcaactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagctgatggcatggtgttcggtgccctccttccctgcgaggaatgctcgggt
cagctggtcttcaagagcgatgcctattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaaacaggaccgtatattccccccagaa
accagcgcctccgtggcggccacgcctccgccctccacagcctcggctcctgctgctgtg
aactcctctgcttcagcagataagccattatccaacatgaagatcctgactctcgggaag
ctgtcccggaacaaggatgaagtgaaggccatgattgagaaactcggggggaagttgacg
gggacggccaacaaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacgtctccgcctccaccaagagccttcaggagttgttcttagcgcacatcttgtcccct
tggggggcagaggtgaaggcagagcctgttgaagttgtggccccaagagggaagtcaggg
gctgcgctctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtcttcagtgccacccttggcctggtg
gacatcgttaaaggaaccaactcctactacaagctgcagcttctggaggacgacaaggaa
aacaggtattggatattcaggtcctggggccgtgtgggtacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacgaagtatcccaaaaagttctacccc
ctggagattgactatggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagatgatctttgatgtggaa
agtatgaagaaagccatggtggagtatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcatactccatcctcagtgaggtccagcaggcggtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccacgactttgggatgaagaagcctccgctcctgaacaatgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggatcccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttgacagagattctgaagaagccgagatcatcaggaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagag
cgtgaaggcgaatgccagcgttacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgctgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcgcccgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcctg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaactacccctgatccttcagct
aacattagtctggatggtgtagacgttcctcttgggaccgggatttcatctggtgtgaat
gacacctctctactatataacgagtacattgtctatgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

DBGET integrated database retrieval system