KEGG   Homo sapiens (human): 1967
Entry
1967              CDS       T01001                                 

Symbol
EIF2B1, EIF2B, EIF2BA
Name
(RefSeq) eukaryotic translation initiation factor 2B subunit alpha
  KO
K03239  translation initiation factor eIF-2B subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    1967 (EIF2B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1967 (EIF2B1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    1967 (EIF2B1)
SSDB
Motif
Pfam: IF-2B
Other DBs
NCBI-GeneID: 1967
NCBI-ProteinID: NP_001405
OMIM: 606686
HGNC: 3257
Ensembl: ENSG00000111361
Vega: OTTHUMG00000168696
Pharos: Q14232(Tbio)
UniProt: Q14232
Structure
LinkDB
Position
12:complement(123620406..123633686)
AA seq 305 aa
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
NT seq 918 nt   +upstreamnt  +downstreamnt
atggacgacaaggagttaattgaatactttaagtctcagatgaaagaagatcctgacatg
gcctcagcagtggctgccatccggacgttgctggagttcttgaagagagataaaggggag
acaatccagggtctgagggcgaatctcaccagtgccatagaaaccctgtgtggtgtggac
tcctctgtggcagtgtcctctggcggggagctcttcctccgcttcatcagtcttgcctcc
ctggaatactccgattactccaaatgtaaaaagatcatgattgagcggggagaacttttt
ctcaggagaatatcactgtcaagaaacaaaattgcagatctgtgccatactttcatcaaa
gatggagcgacaatattgactcacgcctactccagagtggtcctgagagtcctggaagca
gccgtggcggccaagaagcgatttagtgtatacgtcacagagtcacagcctgatttgtca
ggtaagaaaatggccaaagccctctgccacctcaacgtccctgtcactgtggtgctagat
gctgctgtcggctacatcatggagaaagcagatcttgtcatagttggtgctgaaggagtt
gttgaaaacggaggaattattaacaagattggaaccaaccagatggctgtgtgtgccaaa
gcacagaacaaacctttctatgtggttgcagaaagtttcaagtttgtccggctctttcca
ctaaaccagcaagacgtcccagataagtttaagtataaggcagacactctcaaggtcgcg
cagactggacaagacctcaaagaggagcatccgtgggtcgactacactgccccttcctta
atcactctgctgtttacagacctgggcgtgctgacaccctcagcagtcagcgatgagctc
atcaagctctatctgtaa

DBGET integrated database retrieval system