KEGG   Homo sapiens (human): 1969
Entry
1969              CDS       T01001                                 
Symbol
EPHA2, ARCC2, CTPA, CTPP1, CTRCT6, ECK
Name
(RefSeq) EPH receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
Network
nt06526  MAPK signaling
nt06530  PI3K signaling
  Element
N01592  GF-RTK-RAS-ERK signaling pathway
N01599  Regulation of GF-RTK-RAS-ERK signaling, ubiquitination of RTK by CBL
N01656  GF-RTK-PI3K signaling pathway
N01658  GF-RTK-RAS-PI3K signaling pathway
Disease
H01202  Cataract
Drug target
Dasatinib (DG00714): D03658<JP> D06414<JP/US> D12609
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1969 (EPHA2)
   04014 Ras signaling pathway
    1969 (EPHA2)
   04015 Rap1 signaling pathway
    1969 (EPHA2)
   04151 PI3K-Akt signaling pathway
    1969 (EPHA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1969 (EPHA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1969 (EPHA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1969 (EPHA2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   1969 (EPHA2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Interfer-bind ABC1 Ephrin_rec_like Haspin_kinase CD34_antigen TM_ErbB1 Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 1969
NCBI-ProteinID: NP_004422
OMIM: 176946
HGNC: 3386
Ensembl: ENSG00000142627
UniProt: P29317
Structure
LinkDB
Position
1:complement(16124337..16156069)
AA seq 976 aa
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggagctccaggcagcccgcgcctgcttcgccctgctgtggggctgtgcgctggccgcg
gccgcggcggcgcagggcaaggaagtggtactgctggactttgctgcagctggaggggag
ctcggctggctcacacacccgtatggcaaagggtgggacctgatgcagaacatcatgaat
gacatgccgatctacatgtactccgtgtgcaacgtgatgtctggcgaccaggacaactgg
ctccgcaccaactgggtgtaccgaggagaggctgagcgtatcttcattgagctcaagttt
actgtacgtgactgcaacagcttccctggtggcgccagctcctgcaaggagactttcaac
ctctactatgccgagtcggacctggactacggcaccaacttccagaagcgcctgttcacc
aagattgacaccattgcgcccgatgagatcaccgtcagcagcgacttcgaggcacgccac
gtgaagctgaacgtggaggagcgctccgtggggccgctcacccgcaaaggcttctacctg
gccttccaggatatcggtgcctgtgtggcgctgctctccgtccgtgtctactacaagaag
tgccccgagctgctgcagggcctggcccacttccctgagaccatcgccggctctgatgca
ccttccctggccactgtggccggcacctgtgtggaccatgccgtggtgccaccggggggt
gaagagccccgtatgcactgtgcagtggatggcgagtggctggtgcccattgggcagtgc
ctgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctcgcctggattt
tttaagtttgaggcatctgagagcccctgcttggagtgccctgagcacacgctgccatcc
cctgagggtgccacctcctgcgagtgtgaggaaggcttcttccgggcacctcaggaccca
gcgtcgatgccttgcacacgacccccctccgccccacactacctcacagccgtgggcatg
ggtgccaaggtggagctgcgctggacgccccctcaggacagcgggggccgcgaggacatt
gtctacagcgtcacctgcgaacagtgctggcccgagtctggggaatgcgggccgtgtgag
gccagtgtgcgctactcggagcctcctcacggactgacccgcaccagtgtgacagtgagc
gacctggagccccacatgaactacaccttcaccgtggaggcccgcaatggcgtctcaggc
ctggtaaccagccgcagcttccgtactgccagtgtcagcatcaaccagacagagcccccc
aaggtgaggctggagggccgcagcaccacctcgcttagcgtctcctggagcatccccccg
ccgcagcagagccgagtgtggaagtacgaggtcacttaccgcaagaagggagactccaac
agctacaatgtgcgccgcaccgagggtttctccgtgaccctggacgacctggccccagac
accacctacctggtccaggtgcaggcactgacgcaggagggccagggggccggcagcaag
gtgcacgaattccagacgctgtccccggagggatctggcaacttggcggtgattggcggc
gtggctgtcggtgtggtcctgcttctggtgctggcaggagttggcttctttatccaccgc
aggaggaagaaccagcgtgcccgccagtccccggaggacgtttacttctccaagtcagaa
caactgaagcccctgaagacatacgtggacccccacacatatgaggaccccaaccaggct
gtgttgaagttcactaccgagatccatccatcctgtgtcactcggcagaaggtgatcgga
gcaggagagtttggggaggtgtacaagggcatgctgaagacatcctcggggaagaaggag
gtgccggtggccatcaagacgctgaaagccggctacacagagaagcagcgagtggacttc
ctcggcgaggccggcatcatgggccagttcagccaccacaacatcatccgcctagagggc
gtcatctccaaatacaagcccatgatgatcatcactgagtacatggagaatggggccctg
gacaagttccttcgggagaaggatggcgagttcagcgtgctgcagctggtgggcatgctg
cggggcatcgcagctggcatgaagtacctggccaacatgaactatgtgcaccgtgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaggtgtctgactttggcctg
tcccgcgtgctggaggacgaccccgaggccacctacaccaccagtggcggcaagatcccc
atccgctggaccgccccggaggccatttcctaccggaagttcacctctgccagcgacgtg
tggagctttggcattgtcatgtgggaggtgatgacctatggcgagcggccctactgggag
ttgtccaaccacgaggtgatgaaagccatcaatgatggcttccggctccccacacccatg
gactgcccctccgccatctaccagctcatgatgcagtgctggcagcaggagcgtgcccgc
cgccccaagttcgctgacatcgtcagcatcctggacaagctcattcgtgcccctgactcc
ctcaagaccctggctgactttgacccccgcgtgtctatccggctccccagcacgagcggc
tcggagggggtgcccttccgcacggtgtccgagtggctggagtccatcaagatgcagcag
tatacggagcacttcatggcggccggctacactgccatcgagaaggtggtgcagatgacc
aacgacgacatcaagaggattggggtgcggctgcccggccaccagaagcgcatcgcctac
agcctgctgggactcaaggaccaggtgaacactgtggggatccccatctga

DBGET integrated database retrieval system