KEGG   Homo sapiens (human): 4171
Entry
4171              CDS       T01001                                 
Symbol
MCM2, BM28, CCNL1, CDCL1, D3S3194, DFNA70, MITOTIN, cdc19
Name
(RefSeq) minichromosome maintenance complex component 2
  KO
K02540  DNA replication licensing factor MCM2 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4171 (MCM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4171 (MCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4171 (MCM2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4171 (MCM2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4171 (MCM2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4171 (MCM2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4171 (MCM2)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_3 AAA_5 AAA_lid_2 AAA AAA_2 Sigma54_activ_2
Other DBs
NCBI-GeneID: 4171
NCBI-ProteinID: NP_004517
OMIM: 116945
HGNC: 6944
Ensembl: ENSG00000073111
Vega: OTTHUMG00000159637
Pharos: P49736(Tbio)
UniProt: P49736
Structure
LinkDB
Position
3:127598411..127622436
AA seq 904 aa
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggcggaatcatcggaatccttcaccatggcatccagcccggcccagcgtcggcgaggc
aatgatcctctcacctccagccctggccgaagctcccggcgtactgatgccctcacctcc
agccctggccgtgaccttccaccatttgaggatgagtccgaggggctcctaggcacagag
gggcccctggaggaagaagaggatggagaggagctcattggagatggcatggaaagggac
taccgcgccatcccagagctggacgcctatgaggccgagggactggctctggatgatgag
gacgtagaggagctgacggccagtcagagggaggcagcagagcgggccatgcggcagcgt
gaccgggaggctggccggggcctgggccgcatgcgccgtgggctcctgtatgacagcgat
gaggaggacgaggagcgccctgcccgcaagcgccgccaggtggagcgggccacggaggac
ggcgaggaggacgaggagatgatcgagagcatcgagaacctggaggatctcaaaggccac
tctgtgcgcgagtgggtgagcatggcgggcccccggctggagatccaccaccgcttcaag
aacttcctgcgcactcacgtcgacagccacggccacaacgtcttcaaggagcgcatcagc
gacatgtgcaaagagaaccgtgagagcctggtggtgaactatgaggacttggcagccagg
gagcacgtgctggcctacttcctgcctgaggcaccggcggagctgctgcagatctttgat
gaggctgccctggaggtggtactggccatgtaccccaagtacgaccgcatcaccaaccac
atccatgtccgcatctcccacctgcctctggtggaggagctgcgctcgctgaggcagctg
catctgaaccagctgatccgcaccagtggggtggtgaccagctgcactggcgtcctgccc
cagctcagcatggtcaagtacaactgcaacaagtgcaatttcgtcctgggtcctttctgc
cagtcccagaaccaggaggtgaaaccaggctcctgtcctgagtgccagtcggccggcccc
tttgaggtcaacatggaggagaccatctatcagaactaccagcgtatccgaatccaggag
agtccaggcaaagtggcggctggccggctgccccgctccaaggacgccattctcctcgca
gatctggtggacagctgcaagccaggagacgagatagagctgactggcatctatcacaac
aactatgatggctccctcaacactgccaatggcttccctgtctttgccactgtcatccta
gccaaccacgtggccaagaaggacaacaaggttgctgtaggggaactgaccgatgaagat
gtgaagatgatcactagcctctccaaggatcagcagatcggagagaagatctttgccagc
attgctccttccatctatggtcatgaagacatcaagagaggcctggctctggccctgttc
ggaggggagcccaaaaacccaggtggcaagcacaaggtacgtggtgatatcaacgtgctc
ttgtgcggagaccctggcacagcgaagtcgcagtttctcaagtatattgagaaagtgtcc
agccgagccatcttcaccactggccagggggcgtcggctgtgggcctcacggcgtatgtc
cagcggcaccctgtcagcagggagtggaccttggaggctggggccctggttctggctgac
cgaggagtgtgtctcattgatgaatttgacaagatgaatgaccaggacagaaccagcatc
catgaggccatggagcaacagagcatctccatctcgaaggctggcatcgtcacctccctg
caggctcgctgcacggtcattgctgccgccaaccccataggagggcgctacgacccctcg
ctgactttctctgagaacgtggacctcacagagcccatcatctcacgctttgacatcctg
tgtgtggtgagggacaccgtggacccagtccaggacgagatgctggcccgcttcgtggtg
ggcagccacgtcagacaccaccccagcaacaaggaggaggaggggctggccaatggcagc
gctgctgagcccgccatgcccaacacgtatggcgtggagcccctgccccaggaggtcctg
aagaagtacatcatctacgccaaggagagggtccacccgaagctcaaccagatggaccag
gacaaggtggccaagatgtacagtgacctgaggaaagaatctatggcgacaggcagcatc
cccattacggtgcggcacatcgagtccatgatccgcatggcggaggcccacgcgcgcatc
catctgcgggactatgtgatcgaagacgacgtcaacatggccatccgcgtgatgctggag
agcttcatagacacacagaagttcagcgtcatgcgcagcatgcgcaagacttttgcccgc
tacctttcattccggcgtgacaacaatgagctgttgctcttcatactgaagcagttagtg
gcagagcaggtgacatatcagcgcaaccgctttggggcccagcaggacactattgaggtc
cctgagaaggacttggtggataaggctcgtcagatcaacatccacaacctctctgcattt
tatgacagtgagctcttcaggatgaacaagttcagccacgacctgaaaaggaaaatgatc
ctgcagcagttctga

KEGG   Homo sapiens (human): 4172
Entry
4172              CDS       T01001                                 
Symbol
MCM3, HCC5, P1-MCM3, P1.h, RLFB
Name
(RefSeq) minichromosome maintenance complex component 3
  KO
K02541  DNA replication licensing factor MCM3 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4172 (MCM3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4172 (MCM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4172 (MCM3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4172 (MCM3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4172 (MCM3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4172 (MCM3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4172 (MCM3)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Other DBs
NCBI-GeneID: 4172
NCBI-ProteinID: NP_002379
OMIM: 602693
HGNC: 6945
Ensembl: ENSG00000112118
Vega: OTTHUMG00000014844
Pharos: P25205(Tbio)
UniProt: P25205 A0A0S2Z4T1
Structure
LinkDB
Position
6:complement(52264015..52284742)
AA seq 808 aa
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGT
YRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQ
DTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQV
HTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPF
SSVEIQAALSKMQDDNQVMVSEGIIFLI
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggcgggtaccgtggtgctggacgatgtggagctgcgggaggctcagagagattacctg
gacttcctggacgacgaggaagaccagggaatttatcagagcaaagttcgggagctgatc
agtgacaaccaataccggctgattgtcaatgtgaatgacctgcgcaggaaaaacgagaag
agggctaaccggcttctgaacaatgcctttgaggagctggttgccttccagcgggcctta
aaggattttgtggcctccattgatgctacctatgccaagcagtatgaggagttctacgta
ggactggaaggcagctttggctccaagcacgtctccccgcggactcttacctcctgcttc
ctcagctgtgtggtctgtgtggagggcattgtcactaaatgttctctagttcgtcccaaa
gtcgtccgcagtgtccactactgtcctgctactaagaagaccatagagcgacgttattct
gatctcaccaccctggtggcctttccctccagctctgtctatcctaccaaggatgaggag
aacaatccccttgagacagaatatggcctttctgtctacaaggatcaccagaccatcacc
atccaggagatgccggagaaggccccagccggccagctcccccgctctgtggacgtcatt
ctggatgatgacttggtggataaagcgaagcctggtgaccgggttcaggtggtgggaacc
taccgttgccttcctggaaagaagggaggctacacctctgggaccttcaggactgtcctg
attgcctgtaatgttaagcagatgagcaaggatgctcagccctctttctctgctgaggat
atagccaagatcaagaagttcagtaaaacccgatccaaggatatctttgaccagctggcc
aagtcattggccccaagtatccatgggcatgactatgtcaagaaagcaatcctctgcttg
ctcttgggaggggtggaacgagacctagaaaatggcagccacatccgtggggacatcaat
attcttctaataggagacccatccgttgccaagtctcagcttctgcggtatgtgctttgc
actgcaccccgagctatccccaccactggccggggctcctctggagtgggtctgacggct
gctgtcaccacagaccaggaaacaggagagcgccgtctggaagcaggggccatggtcctg
gctgaccgaggcgtggtttgcattgatgaatttgacaaaatgtctgacatggatcgcaca
gccatccatgaagtgatggagcagggtcgagtgaccattgccaaggctggcatccatgct
cggctgaatgcccgctgcagtgttttggcagctgccaaccctgtctacggcaggtatgac
cagtataagactccaatggagaacattgggctacaggactcactgctgtcacgatttgac
ttgctcttcatcatgctggatcagatggatcctgagcaggatcgggagatctcagaccat
gtccttcggatgcaccgttacagagcacctggggagcaggatggcgatgctatgcccttg
ggtagtgctgtggatatcctggccacagatgatcccaactttagccaggaagatcagcag
gacacccagatttatgagaagcatgacaaccttctacatgggaccaagaagaaaaaggag
aagatggtgagtgcagcattcatgaagaagtacatccatgtggccaaaatcatcaagcct
gtcctgacacaggagtcggccacctacattgcagaagagtattcacgcctgcgcagccag
gatagcatgagctcagacaccgccaggacatctccagttacagcccgaacactggaaact
ctgattcgactggccacagcccatgcgaaggcccgcatgagcaagactgtggacctgcag
gatgcagaggaagctgtggagttggtccagtatgcttactttaagaaggttctggagaag
gagaagaaacgtaagaagcgaagtgaggatgaatcagagacagaagatgaagaggagaaa
agccaagaggaccaggagcagaagaggaagagaaggaagactcgccagccagatgccaaa
gatggggattcatacgacccctatgacttcagtgacacagaggaggaaatgcctcaagta
cacactccaaagacggcagactcacaggagaccaaggaatcccagaaagtggagttgagt
gaatccaggttgaaggcattcaaggtggccctcttggatgtgttccgggaagctcatgcg
cagtcaatcggcatgaatcgcctcacagaatccatcaaccgggacagcgaagagcccttc
tcttcagttgagatccaggctgctctgagcaagatgcaggatgacaatcaggtcatggtg
tctgagggcatcatcttcctcatctga

KEGG   Homo sapiens (human): 4173
Entry
4173              CDS       T01001                                 
Symbol
MCM4, CDC21, CDC54, IMD54, NKCD, NKGCD, P1-CDC21, hCdc21
Name
(RefSeq) minichromosome maintenance complex component 4
  KO
K02212  DNA replication licensing factor MCM4 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Disease
H00094  Immunodeficiency associated with DNA repair defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4173 (MCM4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4173 (MCM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4173 (MCM4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4173 (MCM4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4173 (MCM4)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 AAA DUF6260 HypA Elf1
Other DBs
NCBI-GeneID: 4173
NCBI-ProteinID: NP_005905
OMIM: 602638
HGNC: 6947
Ensembl: ENSG00000104738
Vega: OTTHUMG00000164205
Pharos: P33991(Tbio)
UniProt: P33991 B4DLA6
Structure
LinkDB
Position
8:47960941..47978160
AA seq 863 aa
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgtcgtccccggcgtcgaccccgagccgccgcggcagccggcgtggaagggccaccccc
gcccagacgcctcggagtgaggatgccaggtcatctccctctcagagacgtagaggcgag
gattccacctccacgggggagttgcagccgatgccaacctcgcctggagtggacctgcag
agccctgctgcgcaggacgtgctgttttccagccctccccaaatgcattcttcagctatc
cctcttgactttgatgttagttcaccactgacatacggcactcccagctctcgggtagag
ggaaccccaagaagtggtgttaggggcacacctgtgagacagaggcctgacctgggctct
gcacagaagggcctgcaagtggatctgcagtctgacggggcagcagcagaagatatagtg
gcaagtgagcagtctctaggccaaaaacttgtgatctggggaacagatgtaaatgtggca
gcatgcaaagaaaactttcagagatttcttcagcgttttattgaccctctggctaaagaa
gaagaaaatgttggcatagatattactgaacctctatacatgcaacgacttggggagatt
aatgttattggtgagccatttttaaatgtgaactgtgaacacatcaaatcatttgacaaa
aatttgtacagacaactcatctcttacccacaggaagttattccaacttttgacatggct
gtcaatgaaatcttctttgaccgttaccctgactcaatcttagaacatcagattcaagta
agaccattcaacgcattgaagactaagaatatgagaaacctgaatccagaagacattgac
cagctcatcaccatcagcggcatggtgatcaggacatcccagctgattcccgagatgcag
gaggccttcttccagtgccaagtgtgtgcccacacgacccgggtggagatggaccgcggc
cgcattgcagagcccagtgtgtgcgggcgctgccacaccacccacagcatggcactcatc
cacaaccgctccctcttctctgacaagcagatgatcaagcttcaggagtctccggaagac
atgcctgcagggcagacaccacacacagttatcctgtttgctcacaatgatctcgttgac
aaggtccagcctggggacagagtgaatgttacaggcatctatcgagctgtgcctattcga
gtcaatccaagagtgagtaatgtgaagtctgtctacaaaacccacattgatgtcattcat
tatcggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaactt
ttttcagagaaacgtgtggaattgcttaaggaactttccaggaaaccagacatttatgag
aggcttgcttcagccttggctccaagcatttatgaacatgaagatataaagaagggaatt
ttgcttcagctctttggcgggacaaggaaggattttagtcacactggaaggggcaaattt
cgggctgagatcaacatcttgctgtgtggcgaccctggtaccagcaagtcccagctgctg
cagtacgtgtacaacctcgtccccaggggccagtacacgtctgggaagggctccagtgca
gttggcctcactgcgtacgtaatgaaagaccctgagacaaggcagctggtcctgcagaca
ggtgctcttgtcctgagtgacaacggcatctgctgtatcgatgagttcgacaagatgaat
gaaagtacaagatcggtattgcatgaagtcatggaacagcagactctgtccattgcaaag
gctgggatcatctgtcagctcaatgcgcgcacctctgtcctggcagcagcaaatcccatt
gagtctcagtggaatcctaaaaaaacaaccattgaaaacatccagctgcctcatacttta
ttatcaaggtttgatttgatcttcctcttgctggaccctcaggacgaagcctatgacagg
cgtctggctcaccacctggtcgcactgtactaccagagcgaggagcaggcagaggaggag
ctcctggacatggcggtgctaaaggactacattgcctacgcgcacagcaccatcatgccg
cggctaagtgaggaagccagccaggctctcatcgaggcttatgtagacatgaggaagatt
ggcagtagccggggaatggtttctgcataccctcgacagctagagtcattaatccgctta
gcagaagcccatgctaaagtaagattgtctaacaaagttgaagccattgatgtggaagag
gccaaacgcctccatcgggaagctctgaagcagtctgcaactgatccccggactggcatc
gtggacatatctattcttactacggggatgagtgccacctctcgtaaacggaaagaagaa
ttagctgaagcattgaaaaagcttattttatctaagggcaaaacaccagctctaaaatac
cagcaactttttgaagatattcggggacaatctgacatagcaattactaaagatatgttt
gaagaagcactgcgtgccctggcagatgatgatttcctgacagtgactgggaagaccgtg
cgcttgctctga

KEGG   Homo sapiens (human): 4174
Entry
4174              CDS       T01001                                 
Symbol
MCM5, CDC46, MGORS8, P1-CDC46
Name
(RefSeq) minichromosome maintenance complex component 5
  KO
K02209  DNA replication licensing factor MCM5 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4174 (MCM5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4174 (MCM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4174 (MCM5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4174 (MCM5)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4174 (MCM5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4174 (MCM5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4174 (MCM5)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Other DBs
NCBI-GeneID: 4174
NCBI-ProteinID: NP_006730
OMIM: 602696
HGNC: 6948
Ensembl: ENSG00000100297
Vega: OTTHUMG00000150961
Pharos: P33992(Tbio)
UniProt: P33992 B1AHB0
Structure
LinkDB
Position
22:35400140..35455031
AA seq 734 aa
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgtcgggattcgacgatcctggcattttctacagcgacagcttcgggggcgacgcccag
gccgacgaggggcaggcccgcaaatcgcagctgcagaggcgcttcaaggagttcctgcgg
cagtaccgagtgggcaccgaccgcacgggcttcaccttcaaatacagggatgaactcaag
cggcattacaacctgggggagtactggattgaggtggagatggaggatctggccagcttt
gatgaggacctggccgactacttgtacaagcagccagccgagcacctgcagctgctggag
gaagctgccaaggaggtagctgatgaggtgacccggccccggccttctggggaggaggtg
ctccaggacatccaggtcatgctcaagtcggacgccagcccttccagcattcgtagcctg
aagtcggacatgatgtcacacctggtgaagatccctggcatcatcatcgcggcctctgcg
gtccgtgccaaggccacccgcatctctatccagtgccgcagctgccgcaacaccctcacc
aacattgccatgcgccctggcctcgagggctatgccctgcccaggaagtgcaacacagat
caggctgggcgccccaaatgcccattggacccgtacttcatcatgcccgacaaatgcaaa
tgcgtggacttccagaccctgaagctgcaggagctgcctgatgcagtcccccacggggag
atgcccagacacatgcagctctactgcgacaggtacctgtgtgacaaggtcgtccctggg
aacagggttaccatcatgggcatctactccatcaagaagtttggcctgactaccagcagg
ggccgtgacagggtgggcgtgggcatccgaagctcctacatccgtgtcctgggcatccag
gtggacacagatggctctggccgcagctttgctggggccgtgagcccccaggaggaggag
gagttccgtcgcctggctgccctcccaaatgtctatgaggtcatctccaagagcatcgcc
ccctccatctttgggggcacagacatgaagaaggccattgcctgcctgctctttgggggc
tcccgaaagaggctccctgatggacttactcgccgaggagacatcaacctgctgatgcta
ggggaccctgggacagccaagtcccagcttctgaagtttgtggagaagtgttctcccatt
ggggtatacacgtctgggaaaggcagcagcgcagctggactgacagcctcggtgatgagg
gacccttcgtcccggaatttcatcatggagggcggagccatggtcctggccgatggtggg
gtcgtctgtattgacgagtttgacaagatgcgagaagatgaccgtgtggcaatccacgaa
gccatggagcagcagaccatctctatcgccaaggctgggatcaccaccaccctgaactcc
cgctgctccgtcctggctgctgccaactcagtgttcggccgctgggatgagacgaagggg
gaggacaacattgacttcatgcccaccatcttgtcgcgcttcgacatgatcttcatcgtc
aaggatgagcacaatgaggagagggatgtgatgctggccaagcatgtcatcactctgcac
gtgagcgcactgacacagacacaggctgtggagggcgagattgacctggccaagctgaag
aagtttattgcctactgccgagtgaagtgtggcccccggctgtcagcagaggctgcagag
aaactgaagaaccgctacatcatcatgcggagcggggcccgtcagcacgagagggacagt
gaccgccgctccagcatccccatcactgtgcggcagctggaggccattgtgcgcatcgcg
gaagccctcagcaagatgaagctgcagcccttcgccacagaggcagatgtggaggaggcc
ctgcggctcttccaagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtg
gagggcttcaccagccaggaggaccaggagatgctgagccgcatcgagaagcagctcaag
cgccgctttgccattggctcccaggtgtctgagcacagcatcatcaaggacttcaccaag
cagaaatacccggagcacgccatccacaaggtgctgcagctcatgctgcggcgcggcgag
atccagcatcgcatgcagcgcaaggttctctaccgcctcaagtga

KEGG   Homo sapiens (human): 4175
Entry
4175              CDS       T01001                                 
Symbol
MCM6, MCG40308, Mis5, P105MCM
Name
(RefSeq) minichromosome maintenance complex component 6
  KO
K02542  DNA replication licensing factor MCM6 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4175 (MCM6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4175 (MCM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4175 (MCM6)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4175 (MCM6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4175 (MCM6)
SSDB
Motif
Pfam: MCM MCM_OB MCM6_C MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Other DBs
NCBI-GeneID: 4175
NCBI-ProteinID: NP_005906
OMIM: 601806
HGNC: 6949
Ensembl: ENSG00000076003
Vega: OTTHUMG00000131739
Pharos: Q14566(Tbio)
UniProt: Q14566
Structure
LinkDB
Position
2:complement(135839626..135876443)
AA seq 821 aa
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggacctcgcggcggcagcggagccgggcgccggcagccagcacctggaggtccgcgac
gaggtggccgagaagtgccagaaactgttcctggacttcttggaggagtttcagagcagc
gatggagaaattaaatacttgcaattagcagaggaactgattcgtcctgagagaaacaca
ttggttgtgagttttgtggacctggaacaatttaaccagcaactttccaccaccattcaa
gaggagttctatagagtttacccttacctgtgtcgggccttgaaaacattcgtcaaagac
cgtaaagagatccctcttgccaaggatttttatgttgcattccaagacctgcctaccaga
cacaagattcgagagctcacctcatccagaattggtttgctcactcgcatcagtgggcag
gtggtgcggactcacccagttcacccagagcttgtgagcggaacttttctgtgcttggac
tgtcagacagtgatcagggatgtagaacagcagttcaaatacacacagccaaacatctgc
cgaaatccagtttgtgccaacaggaggagattcttactggatacaaataaatcaagattt
gttgattttcaaaaggttcgtattcaagagacccaagctgagcttcctcgagggagtatc
ccccgcagtttagaagtaattttaagggctgaagctgtggaatcagctcaagctggtgac
aagtgtgactttacagggacactgattgttgtgcctgacgtctccaagcttagcacacca
ggagcacgtgcagaaactaattcccgtgtcagtggtgttgatggatatgagacagaaggc
attcgaggactccgggcccttggtgttagggacctttcttataggctggtctttcttgcc
tgctgtgttgcgccaaccaacccaaggtttggggggaaagagctcagagatgaggaacag
acagctgagagcattaagaaccaaatgactgtgaaagaatgggagaaagtgtttgagatg
agtcaagataaaaatctataccacaatctttgtaccagcctgttccctactatacatggc
aatgatgaagtaaaacggggtgtcctgctgatgctctttggtggcgttccaaagacaaca
ggagaagggacctctcttcgaggggacataaatgtttgcattgttggtgacccaagtaca
gctaagagccaatttctcaagcacgtggaggagttcagccccagagctgtctacaccagt
ggtaaagcgtccagtgctgctggcttaacagcagctgttgtgagagatgaagaatctcat
gagtttgtcattgaggctggagctttgatgttggctgataatggtgtgtgttgtattgat
gaatttgataagatggacgtgcgggatcaagttgctattcatgaagctatggaacagcag
accatatccatcactaaagcaggagtgaaggctactctgaacgcccggacgtccattttg
gcagcagcaaacccaatcagtggacactatgacagatcaaaatcattgaaacagaatata
aatttgtcagctcccatcatgtcccgattcgatctcttctttatccttgtggatgaatgt
aatgaggttacagattatgccattgccaggcgcatagtagatttgcattcaagaattgag
gaatcaattgatcgtgtctattccctcgatgatatcagaagatatcttctctttgcaaga
cagtttaaacccaagatttccaaagagtcagaggacttcattgtggagcaatataaacat
ctccgccagagagatggttctggagtgaccaagtcttcatggaggattacagtgcgacag
cttgagagcatgattcgtctctctgaagctatggctcggatgcactgctgtgatgaggtc
caacctaaacatgtgaaggaagctttccggttactgaataaatcaatcatccgtgtggaa
acacctgatgtcaatctagatcaagaggaagagatccagatggaggtagatgagggtgct
ggtggcatcaatggtcatgctgacagccctgctcctgtgaacgggatcaatggctacaat
gaagacataaatcaagagtctgctcccaaagcctccttaaggctgggcttctctgagtac
tgccgaatctctaaccttattgtgcttcacctcagaaaggtggaagaagaagaggacgag
tcagcattaaagaggagcgagcttgttaactggtacttgaaggaaatcgaatcagagata
gactctgaagaagaacttataaataaaaaaagaatcatagagaaagttattcatcgactc
acacactatgatcatgttctaattgagctcacccaggctggattgaaaggctccacagag
ggaagtgagagctatgaagaagatccctacttggtagttaaccctaactacttgctcgaa
gattga

KEGG   Homo sapiens (human): 4176
Entry
4176              CDS       T01001                                 
Symbol
MCM7, CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146, PPP1R104
Name
(RefSeq) minichromosome maintenance complex component 7
  KO
K02210  DNA replication licensing factor MCM7 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4176 (MCM7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4176 (MCM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    4176 (MCM7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4176 (MCM7)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4176 (MCM7)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4176 (MCM7)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4176 (MCM7)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 MCM_bind AAA_3 Mg_chelatase_C Sigma54_activat AAA_lid_2
Other DBs
NCBI-GeneID: 4176
NCBI-ProteinID: NP_005907
OMIM: 600592
HGNC: 6950
Ensembl: ENSG00000166508
Vega: OTTHUMG00000154671
Pharos: P33993(Tbio)
UniProt: P33993 C6EMX8 A0A0S2Z4A5
Structure
LinkDB
Position
7:complement(100092728..100101397)
AA seq 719 aa
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcactgaaggactacgcgctagagaaggaaaaggttaagaagttcttacaagagttc
taccaggatgatgaactcgggaagaagcagttcaagtatgggaaccagttggttcggctg
gctcatcgggaacaggtggctctgtatgtggacctggacgacgtagccgaggatgacccc
gagttggtggactcaatttgtgagaatgccaggcgctacgcgaagctctttgctgatgcc
gtacaagagctgctgcctcagtacaaggagagggaagtggtaaataaagatgtcctggac
gtttacattgagcatcggctaatgatggagcagcggagtcgggaccctgggatggtccga
agcccccagaaccagtaccctgctgaactcatgcgcagatttgagctgtattttcaaggc
cctagcagcaacaagcctcgtgtgatccgggaagtgcgggctgactctgtggggaagttg
gtaactgtgcgtggaatcgtcactcgtgtctctgaagtcaaacccaagatggtggtggcc
acttacacttgtgaccagtgtggggcagagacctaccagccgatccagtctcccactttc
atgcctctgatcatgtgcccaagccaggagtgccaaaccaaccgctcaggagggcggctg
tatctgcagacacggggctccagattcatcaaattccaggagatgaagatgcaagaacat
agtgatcaggtgcctgtgggaaatatccctcgtagtatcacggtgctggtagaaggagag
aacacaaggattgcccagcctggagaccacgtcagcgtcactggtattttcttgccaatc
ctgcgcactgggttccgacaggtggtacagggtttactctcagaaacctacctggaagcc
catcggattgtgaagatgaacaagagtgaggatgatgagtctggggctggagagctcacc
agggaggagctgaggcaaattgcagaggaggatttctacgaaaagctggcagcttcaatc
gccccagaaatatacgggcatgaagatgtgaagaaggcactgctgctcctgctagtcggg
ggtgtggaccagtctcctcgaggcatgaaaatccggggcaacatcaacatctgtctgatg
ggggatcctggtgtggccaagtctcagctcctgtcatacattgatcgactggcgcctcgc
agccagtacacaacaggccggggctcctcaggagtggggcttacggcagctgtgctgaga
gactccgtgagtggagaactgaccttagagggtggggccctggtgctggctgaccagggt
gtgtgctgcattgatgagttcgacaagatggctgaggccgaccgcacagccatccacgag
gtcatggagcagcagaccatctccattgccaaggccggcattctcaccacactcaatgcc
cgctgctccatcctggctgccgccaaccctgcctacgggcgctacaaccctcgccgcagc
ctggagcagaacatacagctacctgctgcactgctctcccggtttgacctcctctggctg
attcaggaccggcccgaccgagacaatgacctacggttggcccagcacatcacctatgtg
caccagcacagccggcagcccccctcccagtttgaacctctggacatgaagctcatgagg
cgttacatagccatgtgccgcgagaagcagcccatggtgccagagtctctggctgactac
atcacagcagcatacgtggagatgaggcgagaggcttgggctagtaaggatgccacctat
acttctgcccggaccctgctggctatcctgcgcctttccactgctctggcacgtctgaga
atggtggatgtggtggagaaagaagatgtgaatgaagccatcaggctaatggagatgtca
aaggactctcttctaggagacaaggggcagacagctaggactcagagaccagcagatgtg
atatttgccaccgtccgtgaactggtctcagggggccgaagtgtccggttctctgaggca
gagcagcgctgtgtatctcgtggcttcacacccgcccagttccaggcggctctggatgaa
tatgaggagctcaatgtctggcaggtcaatgcttcccggacacggatcacttttgtctga

DBGET integrated database retrieval system