KEGG   Homo sapiens (human): 4897
Entry
4897              CDS       T01001                                 
Symbol
NRCAM, NEDNMS
Name
(RefSeq) neuronal cell adhesion molecule
  KO
K06756  neuronal cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    4897 (NRCAM)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY Ig_5 Ig_C17orf99 C2-set_2 Pur_ac_phosph_N Ig_4 fn3_2 SIT INCA1
Other DBs
NCBI-GeneID: 4897
NCBI-ProteinID: NP_001032209
OMIM: 601581
HGNC: 7994
Ensembl: ENSG00000091129
Pharos: Q92823(Tbio)
UniProt: Q92823 Q14CA1
Structure
LinkDB
Position
7:complement(108147649..108456720)
AA seq 1304 aa
MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDP
RENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGV
YQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFW
MDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVIS
VDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
IIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIHHTISVRVKAA
PYWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFS
NVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFG
SPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHL
EIKDPTWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDH
LVVADVSDDDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQLD
KSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLKLSPYVNYSFR
VMAVNSIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGL
QYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHS
GEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIE
KKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKI
VNPTLDSLTLEWDPPSHPNGILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNF
STRYKFYFYAQTSAGSGSQITEEAVTTVDEAGILPPDVGAGKVQAVNPRISNLTAAAAET
YANISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAVG
DSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPV
KEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGE
GVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV
NT seq 3915 nt   +upstreamnt  +downstreamnt
atgcagcttaaaataatgccgaaaaagaagcgcttatctgcgggcagagtgcccctgatt
ctcttcctgtgccagatgattagtgcactggaagtacctcttgatccaaaacttcttgaa
gacttggtacagcctccaaccatcacccaacagtctccaaaagattacattattgaccct
cgggagaatattgtaatccagtgtgaagccaaagggaaaccgcccccaagcttttcctgg
acccgtaatgggactcattttgacatcgataaagaccctctggtcaccatgaagcctggc
acaggaacgctcataattaacatcatgagcgaagggaaagctgagacctatgaaggagtc
tatcagtgtacagcaaggaacgaacgcggagctgcagtttctaataacattgttgtccgc
ccatccagatcaccattgtggaccaaagaaaaacttgaaccaatcacacttcaaagtggt
cagtctttagtacttccctgcagacccccaattggattaccaccacctataatattttgg
atggataattcctttcaaagacttccacaaagtgagagagtttctcaaggtttgaatggg
gacctttatttttccaatgtcctcccagaggacacccgcgaagactatatctgttatgct
agatttaatcatactcaaaccatacagcagaagcaacctatttctgtgaaggtgatttca
gtggatgaattgaatgacactatagctgctaatttgagtgacactgagttttatggtgct
aaatcaagtagagagaggccaccaacatttttaactccagaaggcaatgcaagtaacaaa
gaggaattaagaggaaatgtgctttcactggagtgcattgcagaaggactgcctacccca
attatttactgggcaaaggaagatggaatgctacccaaaaacaggacagtttataagaac
tttgagaaaaccttgcagatcattcatgtttcagaagcagactctggaaattaccaatgt
atagcaaaaaacgcattaggagccatccaccataccatttctgttagagttaaagcggct
ccatactggatcacagcccctcaaaatcttgtgctgtccccaggagaggatgggaccttg
atctgcagagctaatggcaaccccaaacccagaattagctggttaacaaatggagtccca
atagaaattgcccctgatgaccccagcagaaaaatagatggcgataccattattttttca
aatgttcaagaaagatcaagtgcagtctatcagtgcaatgcctctaatgaatatggatat
ttactggcaaacgcatttgtaaatgtgctggctgagccaccacgaatcctcacacctgca
aacacactctaccaggtcattgcaaacaggcctgctttactagactgtgccttctttggg
tctcctctcccaaccatcgagtggtttaaaggagctaaaggaagtgctcttcatgaagat
atttatgttttacatgaaaatggaactttggaaattcctgtggcccaaaaggacagtaca
ggaacttatacgtgtgttgcaaggaataaattagggatggcgaagaatgaagttcactta
gaaatcaaagatcctacatggatcgttaaacagcccgaatatgcagttgtgcaaagaggg
agcatggtgtcctttgaatgcaaagtgaaacatgatcacaccttatccctcactgtcctg
tggctgaaggacaacagggaactgcccagtgatgaaaggttcactgttgacaaggatcat
ctagtggtagctgatgtcagtgacgatgacagcgggacctacacgtgtgtggccaacacc
actctggacagcgtctccgccagcgctgtgcttagcgttgttgctcctactccaactcca
gctcccgtttacgatgtcccaaatcctccctttgacttagaactgacagatcaacttgac
aaaagtgttcagctgtcatggaccccaggcgatgacaacaatagccccattacaaaattc
atcatcgaatatgaagatgcaatgcacaagccagggctgtggcaccaccaaactgaagtt
tctggaacacagaccacagcccagctgaagctgtctccttacgtgaactactccttccgc
gtgatggcagtgaacagcattgggaagagcttgcccagcgaggcgtctgagcagtatttg
acgaaagcctcagaaccagataaaaaccccacagctgtggaaggactgggatcagagcct
gataatttggtgattacgtggaagcccttgaatggtttcgaatctaatgggccaggcctt
cagtacaaagttagctggcgccagaaagatggtgatgatgaatggacatctgtggttgtg
gcaaatgtatccaaatatattgtctcaggcacgccaacctttgttccatacctgatcaaa
gttcaggccctgaatgacatggggtttgcccccgagccagctgtagtcatgggacattct
ggagaagacctcccaatggtggctcctgggaacgtgcgtgtgaatgtggtgaacagtacc
ttagccgaggtgcactgggacccagtacctctgaaaagcatccgaggacacctacaaggc
tatcggatttactattggaagacccagagttcatctaaaagaaacagacgtcacattgag
aaaaagatcctcaccttccaaggcagcaagactcatggcatgttgccggggctagagccc
tttagccactacacactgaatgtccgagtggtcaatgggaaaggggagggcccagccagc
cctgacagagtctttaatactccagaaggagtccccagtgctccctcgtctttgaagatt
gtgaatccaacactggactctctcactttggaatgggatccaccgagccacccgaatggc
attttgacagagtacaccttaaagtatcagccaattaacagcacacatgaattaggccct
ctggtagatttgaaaattcctgccaacaagacacggtggactttaaaaaatttaaatttc
agcactcgatataagttttatttctatgcacaaacatcagcaggatcaggaagtcaaatt
acagaggaagcagtaacaactgtggatgaagctggtattcttccacctgatgtaggtgca
ggcaaagttcaagcagtaaatcccaggatcagcaatcttactgctgcagctgctgagacc
tatgccaatatcagttgggaatatgagggaccagagcatgtgaacttttatgttgaatat
ggtgtagcaggcagcaaagaagaatggagaaaagaaattgtaaatggttctcggagcttc
tttgggttaaagggtctaatgccaggaacagcatacaaagttcgagttggtgctgtgggg
gactctggttttgtgagttcagaggatgtgtttgagacaggcccagcgatggcaagccgg
caggtggatattgcaactcagggctggttcattggtctgatgtgtgctgttgctctcctt
atcttaattttgctgattgtttgcttcatcagaagaaacaagggtggtaaatatccagtt
aaagaaaaggaagatgcccatgctgaccctgaaatccagcctatgaaggaagatgatggg
acatttggagaatacagtgatgcagaagaccacaagcctttgaaaaaaggaagtcgaact
ccttcagacaggactgtgaaaaaagaagatagtgacgacagcctagttgactatggagaa
ggggttaatggccagttcaatgaggatggctcctttattggacaatacagtggtaagaaa
gagaaagagccggctgaaggaaacgaaagctcagaggcaccttctcctgtcaacgccatg
aattcctttgtttaa

DBGET integrated database retrieval system