KEGG   Homo sapiens (human): 54567
Entry
54567             CDS       T01001                                 
Symbol
DLL4, AOS6, delta4, hdelta2
Name
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
nt06511  NOTCH signaling
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
N01479  Notch ligand ubiquitylation
Disease
H01413  Adams-Oliver syndrome
Drug target
Demcizumab: D10353
Dilpacimab: D11642
Enoticumab: D10460
Navicixizumab: D11126
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    54567 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    54567 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54567 (DLL4)
   05207 Chemical carcinogenesis - receptor activation
    54567 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    54567 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54567 (DLL4)
SSDB
Motif
Pfam: MNNL EGF hEGF DSL EGF_2 EGF_3 DUF4381 EGF_CA Laminin_EGF
Other DBs
NCBI-GeneID: 54567
NCBI-ProteinID: NP_061947
OMIM: 605185
HGNC: 2910
Ensembl: ENSG00000128917
Pharos: Q9NR61(Tbio)
UniProt: Q9NR61
Structure
LinkDB
Position
15:40929340..40939073
AA seq 685 aa
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctccggcgtcttccagctgcagctgcaggagttcatcaacgag
cgcggcgtactggccagtgggcggccttgcgagcccggctgccggactttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccggaccctgcaccttcgggaccgtctcc
acgccggtattgggcaccaactccttcgctgtccgggacgacagtagcggcggggggcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcgctcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattggatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactatgtgtgc
cagccagatggcaacttgtcctgcctgcccggttggactggggaatattgccaacagcct
atctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccaggctggcagggccggctgtgtaacgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcactccctggcaatgtacttgtgatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccatgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctacacctgcacctgtcgcccaggctacactggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcctccgggctactatggcctgcattgtgaa
cacagcaccttgagctgcgccgactccccctgcttcaatgggggctcctgccgggagcgc
aaccagggggccaactatgcttgtgaatgtccccccaacttcaccggctccaactgcgag
aagaaagtggacaggtgcaccagcaacccctgtgccaacgggggacagtgcctgaaccga
ggtccaagccgcatgtgccgctgccgtcctggattcacgggcacctactgtgaactccac
gtcagcgactgtgcccgtaacccttgcgcccacggtggcacttgccatgacctggagaat
gggctcatgtgcacctgccctgccggcttctctggccgacgctgtgaggtgcggacatcc
atcgatgcctgtgcctcgagtccctgcttcaacagggccacctgctacaccgacctctcc
acagacacctttgtgtgcaactgcccttatggctttgtgggcagccgctgcgagttcccc
gtgggcttgccgcccagcttcccctgggtggccgtctcgctgggtgtggggctggcagtg
ctgctggtactgctgggcatggtggcagtggctgtgcggcagctgcggcttcgacggccg
gacgacggcagcagggaagccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccagcttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccacacattggactataatctggccccaggg
cccctggggcgggggaccatgccaggaaagtttccccacagtgacaagagcttaggagag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaatgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system