KEGG   Homo sapiens (human): 5527
Entry
5527              CDS       T01001                                 
Symbol
PPP2R5C, B56G, B56gamma, PR61G
Name
(RefSeq) protein phosphatase 2 regulatory subunit B'gamma
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5527 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5527 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    5527 (PPP2R5C)
   04152 AMPK signaling pathway
    5527 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5527 (PPP2R5C)
   04114 Oocyte meiosis
    5527 (PPP2R5C)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5527 (PPP2R5C)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5527 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    5527 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5527 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5527 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5527 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5527 (PPP2R5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5527 (PPP2R5C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5527 (PPP2R5C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5527 (PPP2R5C)
SSDB
Motif
Pfam: B56 MvaI_BcnI
Other DBs
NCBI-GeneID: 5527
NCBI-ProteinID: NP_002710
OMIM: 601645
HGNC: 9311
Ensembl: ENSG00000078304
UniProt: Q13362
LinkDB
Position
14:101760573..101927992
AA seq 524 aa
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccaactccaatggg
cctttccagcccgtggtccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgcgtcctctttgactttgtttctgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgaaatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacattaccaccttcctccaatcctacgggagcggaatttgacccg
gaggaagatgaaccaacgttagaagcagcctggcctcatctacagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatcctcgggagagagat
tttcttaaaaccacccttcacagaatctatgggaaattcctaggcttgagagcttacatc
agaaaacagataaataatatattttataggtttatttatgaaacagagcatcataatggc
atagcagagttactggaaatattgggaagtataattaatggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaaatctctg
agtgtctaccatccccagctggcatactgtgtagtgcagtttttagaaaaggacagcacc
ctcacggaaccagtggtgatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtaatgttcttaaacgaattagaagagattttagatgtcattgaaccatcagaattt
gtgaagatcatggaacccctcttccggcagttggccaaatgtgtctccagcccacacttc
caggtggcagagcgagctctctattactggaataatgaatacatcatgagtttaatcagt
gacaacgcagcgaagattctgcccatcatgtttccttccttgtaccgcaactcaaagacc
cattggaacaagacaatacatggcttgatatacaacgccctgaagctcttcatggagatg
aaccaaaagctatttgatgactgtacacaacagttcaaagcagagaaactaaaagagaag
ctaaaaatgaaagaacgggaagaagcatgggttaaaatagaaaatctagccaaagccaat
ccccagtacacagtgtatagtcaagccagcaccatgagcattccggttgcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaaggacgaggctcat
caggcacagaaagatccgaagaaggaccgtcctcttgcacgccgcaagtccgagctgcct
caggacccccacaccaagaaagccttggaagctcactgcagggccgatgagctggcctcc
caggacggccgctag

DBGET integrated database retrieval system