KEGG   Homo sapiens (human): 64785
Entry
64785             CDS       T01001                                 
Symbol
GINS3, PSF3
Name
(RefSeq) GINS complex subunit 3
  KO
K10734  GINS complex subunit 3
Organism
hsa  Homo sapiens (human)
Network
nt06509  DNA replication
  Element
N01470  Pre-IC formation
N01471  Origin unwinding and elongation
N01473  DNA replication termination
N01474  TRAIP-dependent replisome disassembly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    64785 (GINS3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    64785 (GINS3)
SSDB
Motif
Pfam: Sld5
Other DBs
NCBI-GeneID: 64785
NCBI-ProteinID: NP_073607
OMIM: 610610
HGNC: 25851
Ensembl: ENSG00000181938
Pharos: Q9BRX5(Tbio)
UniProt: Q9BRX5 A0A0S2Z5L0
Structure
LinkDB
Position
16:58392471..58406147
AA seq 216 aa
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAV
PQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFG
SQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQ
KGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtcagaggcttatttccgagtggagtcgggtgcgctggggcctgaggagaactttctt
tctttggacgacatcctgatgtcccacgagaagctgccggtgcgcacggagaccgccatg
cctcgccttggcgctttcttcctggagcggagcgcaggcgccgagactgacaacgcggtc
ccacagggttccaagcttgaactacccttgtggctggcaaaaggactttttgacaacaag
cgacggatcctttctgtggaactccccaagatctaccaagagggttggaggactgtgttc
agtgcagatcccaatgtggtggacctccacaaaatggggccccatttctacgggtttggc
tcccagctcctgcattttgacagtcccgagaatgcagacatttcccagtctctgctgcag
acttttatcggacgttttcgccgcatcatggactcctcacagaatgcttacaacgaagac
acttcagccctggtagccaggctagacgagatggagaggggcttatttcaaacagggcag
aaaggactgaatgactttcagtgttgggagaaggggcaggcttctcagatcacagcttcc
aacctcgttcagaattacaagaagagaaaattcactgatatggaagactga

DBGET integrated database retrieval system