KEGG   Homo sapiens (human): 6608
Entry
6608              CDS       T01001                                 
Symbol
SMO, CRJS, FZD11, Gx, PHLS, SMOH
Name
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00039  Basal cell carcinoma
H01556  Meningioma
H01667  Medulloblastoma
Drug target
Glasdegib (DG02912): D10636 D11107<US>
Patidegib  
Saridegib (DG01274): D10324 D10325
Sonidegib (DG01854): D10119 D10729<US>
Taladegib: D10671
Vismodegib: D09992<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    6608 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    6608 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6608 (SMO)
   05205 Proteoglycans in cancer
    6608 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    6608 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6608 (SMO)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  6608 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 6608
NCBI-ProteinID: NP_005622
OMIM: 601500
HGNC: 11119
Ensembl: ENSG00000128602
Pharos: Q99835(Tclin)
UniProt: Q99835
Structure
LinkDB
Position
7:129188633..129213545
AA seq 787 aa
MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPP
LSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTEL
MDADSDF
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggccgctgcccgcccagcgcgggggccggagctcccgctcctggggctgctgctgctg
ctgctgctgggggacccgggccggggggcggcctcgagcgggaacgcgaccgggcctggg
cctcggagcgcgggcgggagcgcgaggaggagcgcggcggtgactggccctccgccgccg
ctgagccactgcggccgggctgccccctgcgagccgctgcgctacaacgtgtgcctgggc
tcggtgctgccctacggggccacctccacactgctggccggagactcggactcccaggag
gaagcgcacggcaagctcgtgctctggtcgggcctccggaatgccccccgctgctgggca
gtgatccagcccctgctgtgtgccgtatacatgcccaagtgtgagaatgaccgggtggag
ctgcccagccgtaccctctgccaggccacccgaggcccctgtgccatcgtggagagggag
cggggctggcctgacttcctgcgctgcactcctgaccgcttccctgaaggctgcacgaat
gaggtgcagaacatcaagttcaacagttcaggccagtgcgaagtgcccttggttcggaca
gacaaccccaagagctggtacgaggacgtggagggctgcggcatccagtgccagaacccg
ctcttcacagaggctgagcaccaggacatgcacagctacatcgcggccttcggggccgtc
acgggcctctgcacgctcttcaccctggccacattcgtggctgactggcggaactcgaat
cgctaccctgctgttattctcttctacgtcaatgcgtgcttctttgtgggcagcattggc
tggctggcccagttcatggatggtgcccgccgagagatcgtctgccgtgcagatggcacc
atgaggcttggggagcccacctccaatgagactctgtcctgcgtcatcatctttgtcatc
gtgtactacgccctgatggctggtgtggtttggtttgtggtcctcacctatgcctggcac
acttccttcaaagccctgggcaccacctaccagcctctctcgggcaagacctcctacttc
cacctgctcacctggtcactcccctttgtcctcactgtggcaatccttgctgtggcgcag
gtggatggggactctgtgagtgggatttgttttgtgggctacaagaactaccgataccgt
gcgggcttcgtgctggccccaatcggcctggtgctcatcgtgggaggctacttcctcatc
cgaggagtcatgactctgttctccatcaagagcaaccaccccgggctgctgagtgagaag
gctgccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctggccttt
ggctttgtgctcattaccttcagctgccacttctacgacttcttcaaccaggctgagtgg
gagcgcagcttccgggactatgtgctatgtcaggccaatgtgaccatcgggctgcccacc
aagcagcccatccctgactgtgagatcaagaatcgcccgagccttctggtggagaagatc
aacctgtttgccatgtttggaactggcatcgccatgagcacctgggtctggaccaaggcc
acgctgctcatctggaggcgtacctggtgcaggttgactgggcagagtgacgatgagcca
aagcggatcaagaagagcaagatgattgccaaggccttctctaagcggcacgagctcctg
cagaacccaggccaggagctgtccttcagcatgcacactgtgtcccacgacgggcccgtg
gcgggcttggcctttgacctcaatgagccctcagctgatgtctcctctgcctgggcccag
catgtcaccaagatggtggctcggagaggagccatactgccccaggatatttctgtcacc
cctgtggcaactccagtgcccccagaggaacaagccaacctgtggctggttgaggcagag
atctccccagagctgcagaagcgcctgggccggaagaagaagaggaggaagaggaagaag
gaggtgtgcccgctggcgccgccccctgagcttcacccccctgcccctgcccccagtacc
attcctcgactgcctcagctgccccggcagaaatgcctggtggctgcaggtgcctgggga
gctggggactcttgccgacagggagcgtggaccctggtctccaacccattctgcccagag
cccagtccccctcaggatccatttctgcccagtgcaccggcccccgtggcatgggctcat
ggccgccgacagggcctggggcctattcactcccgcaccaacctgatggacacagaactc
atggatgcagactcggacttctga

KEGG   Homo sapiens (human): 2121
Entry
2121              CDS       T01001                                 
Symbol
EVC, DWF-1, EVC1, EVCL
Name
(RefSeq) EvC ciliary complex subunit 1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00062  Hedgehog signaling pathway
Disease
H00503  Ellis-van Creveld syndrome
H02158  Weyers acrofacial dysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2121 (EVC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    2121 (EVC)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  EVC complex
   2121 (EVC)
SSDB
Motif
Pfam: BORCS6 DUF1154
Other DBs
NCBI-GeneID: 2121
NCBI-ProteinID: NP_714928
OMIM: 604831
HGNC: 3497
Ensembl: ENSG00000072840
Pharos: P57679(Tbio)
UniProt: P57679
LinkDB
Position
4:5711201..5829057
AA seq 992 aa
MARGGAACKSDARLLLGRDALRPAPALLAPAVLLGAALGLGLGLWLGCRAGRQRTRHQKD
DTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITAFALKAKVI
YPINQKFRPLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHS
ATSDDRFLSRTFLRVNAFPEVLACESVDVDLCIYSLHLKDLLHLDTALRQEKHMMFIQIF
KMCLLDLLPKKKSDDELYQKILSKQEKDLEELEKGLQVKLSNTEMSGAGDSEYITLADVE
KKEREYSEQLIDNMEAFWKQMANIQHFLVDQFKCSSSKARQLMMTLTERMIAAEGLLCDS
QELQALDALERTMGRAHMAKVIEFLKLQVQEETRCRLAAISHGLELLAGEGKLSGRQKEE
LLTQQHKAFWQEAERFSREFVQRGKDLVTASLAHQVEGTAKLTLAQEEEQRSFLAEAQPT
ADPEKFLEAFHEVLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFL
QTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECAL
SSVLQTHLREDHEGTIRGVLGRLGGLTEESTRCVLQGHDLLLRSALRRLALRGNALATLT
QMRLSGKKHLLQELREQRALEQGSSQCLDEHQWQLLRALEARVLEEASRLEEEAQQTRLQ
LQQRLLAEAQEVGQLLQQHMECAIGQALLVHARNAATKSRAKDRDDFKRTLMEAAVESVY
VTSAGVSRLVQAYYQQIGRIMEDHEERKLQHLKTLQGERMENYKLRKKQELSNPSSGSRT
AGGAHETSQAVHQRMLSQQKRFLAQFPVHQQMRLHAQQQQAGVMDLLEAQLETQLQEAEQ
NFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQT
SGSLSSKRLSQQESEAGDSGNSKKMLKRRSNL
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggcccgcggcggggcggcctgcaagagcgacgcgcggctgctgctggggcgggacgcg
ctgcggccggcgcccgccctgctggcccccgccgtgctgctgggcgccgcgctcggcctc
ggcctcggcctttggcttggctgccgcgcgggccgccagcgcacgcgacaccagaaagac
gacactcaaaatctgctcaagaatttggagtctaatgcgcagaccccctcggaaactggc
tccccatcaaggaggaggaagagagaagtgcagatgtcgaaggacaaggaagctgttgat
gaatgtgagccgccttccaacagcaatatcacagcattcgccctgaaggccaaagtcatc
taccccatcaatcagaagttccggcctctggccgatggctcctccaacccgtctctgcat
gaaaacttaaagcaggctgttttgccacaccagccggtagaggcctctccttccagcagt
ctggggagcctgagccagggtgagaaggacgactgcagctcctcatccagcgtccactcg
gccaccagcgatgacaggtttctcagccgcaccttcctccgggtgaacgccttccctgaa
gtgctggcctgcgagagtgtagacgttgacctgtgtatctacagccttcacttaaaagac
ctgctgcatttggacacggcactgaggcaggaaaagcatatgatgtttattcagattttt
aaaatgtgcctccttgaccttcttcctaaaaagaagtcagatgatgaactataccagaag
atcctttcaaaacaagaaaaagatttggaggaactagaaaagggacttcaggtcaaactg
tcaaacacagaaatgtcgggggctggtgactctgagtacatcaccctggctgatgtggaa
aagaaggagagagaatactctgaacagctaatcgataatatggaagctttctggaaacag
atggcaaatatccagcactttcttgtggaccagtttaagtgttccagctccaaagcccga
cagctgatgatgactctgacggaaagaatgattgcagccgaagggctattgtgcgattct
caggagctgcaggctctggacgccctggagaggacgatggggcgggcgcacatggcaaaa
gtgattgagtttctgaagctgcaagtccaggaggagaccaggtgccggctggctgccatc
tcccacggcctggagctgctggctggtgaggggaagctgtccgggcggcagaaggaggag
ctgctcacgcagcagcacaaggccttctggcaggaggcagagcgcttcagccgggagttt
gtccagcgaggcaaagacctggtcacggcgtctctggctcaccaggtggagggaacggca
aaactcacgctggcccaagaggaggaacagagaagcttcctggctgaggcccagccgact
gctgacccggaaaagtttctcgaggcttttcatgaggtcctggagaggcagaggctgatg
cagtgtgacctggaggaagaggagaatgtcagagccaccgaggctgtggttgcactctgc
caggagctgtacttcagcaccgtggacactttccagaagttcgtggatgccctgttcctt
cagacgctccctggcatgactggcctccccccggaagagtgtgactacttgaggcaggaa
gtccaggagaacgctgcctggcagctggggaagtcaaatcgcttccggaggcagcagtgg
aaactcttccaggagctcctagagcaagaccagcaggtgtggatggaggagtgtgcgctg
tccagcgtgctgcagacacacctgcgggaggaccacgagggcaccatccgcggcgtcttg
ggccgactgggcggcctcactgaagagtccacgcggtgtgtcctgcaggggcatgacctg
ctgttgcgctcagccctccggaggctggcactccgcggcaacgccctggccaccctgacg
cagatgcggctatcggggaagaagcacctcctgcaggagctgcgggaacagcgtgcactg
gagcaggggtcctcccagtgcctggacgagcatcagtggcagctgctcagggccctggag
gcgcgtgtgctggaggaggccagccggctagaggaggaagcacagcagacacggctgcag
ctccagcagcggctcctggccgaggcccaggaggtggggcagcttctgcagcagcacatg
gagtgcgccattgggcaggcgctgctggtgcatgcacggaatgcagccaccaagagccgg
gccaaggacagggatgacttcaagaggacactgatggaggcggcagtggagagcgtctac
gtgaccagcgctggtgtcagccgcctggtgcaggcgtattaccagcaaatcggaaggatc
atggaggaccacgaggagagaaaactgcagcacctgaagaccctgcagggtgagaggatg
gaaaattacaaactgcggaaaaagcaagaactcagcaacccttcgtcgggcagcaggacg
gcaggtggcgctcatgagacctcccaggcggtccaccagaggatgctgtcccagcagaag
aggttcctggcccagttcccagtgcaccagcagatgcgtctgcacgcccagcagcagcag
gcaggagtcatggaccttctggaagcccagctggagacccagctacaggaagctgaacag
aacttcatctccgagctggcagccttggcccgagtgccccttgctgaaagcaaactgttg
cctgctaagcgtgggctgctagagaagcccctaaggactaaaaggaagaagcccctgccc
caggaaagaggggacctgggggtgcccaacaatgaggaccttgcctccggggaccagacc
tcaggctcactcagcagcaaaaggctgagtcagcaagaaagtgaagctggggacagtggg
aactcaaagaagatgctaaagagaagaagcaacttgtag

KEGG   Homo sapiens (human): 132884
Entry
132884            CDS       T01001                                 
Symbol
EVC2, LBN, WAD
Name
(RefSeq) EvC ciliary complex subunit 2
  KO
K19608  ellis van creveld syndrome protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00062  Hedgehog signaling pathway
Disease
H00503  Ellis-van Creveld syndrome
H01376  Acrofacial dysostosis
H02158  Weyers acrofacial dysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    132884 (EVC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    132884 (EVC2)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  EVC complex
   132884 (EVC2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 132884
NCBI-ProteinID: NP_667338
OMIM: 607261
HGNC: 19747
Ensembl: ENSG00000173040
Pharos: Q86UK5(Tbio)
UniProt: Q86UK5
LinkDB
Position
4:complement(5529011..5709548)
AA seq 1308 aa
MDPSGSRGRPTWVLAGGLLAVALALGGRGCLGASSRPRWRPLGAQPPRDPQVAPRSGPGL
RIPPGRSGAGPESSTQDLPCMIWPKVECCHFKTAVEAPLGMKLDKKMEVFIPLSTSAASS
GPWAHSLFAFIPSWPKKNLFKRESPITHRLYGDISREVQGTSENGVIFQKCALVSGSSEA
QTARIWLLVNNTKTTSSANLSELLLLDSIAGLTIWDSVGNRTSEGFQAFSKKFLQVGDAF
AVSYAATLQAGDLGNGESLKLPAQLTFQSSSRNRTQLKVLFSITAEENVTVLPHHGLHAA
GFFIAFLLSLVLTWAALFLMVRYQCLKGNMLTRHRVWQYESKLEPLPFTSADGVNEDLSL
NDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHL
SPQVERKMSAVFKKQFLLLENEIQEEYDRKMVALTAECDLETRKKMENQYQREMMAMEEA
EELLKRAGERSAVECSNLLRTLHGLEQEHLRKSLALQQEEDFAKAHRQLAVFQRNELHSI
FFTQIKSAIFKGELKPEAAKMLLQNYSKIQENVEELMDFFQASKRYHLSKRFGHREYLVQ
NLQSSETRVQGLLSTAAAQLTHLIQKHERAGYLDEDQMEMLLERAQTEVFSIKQKLDNDL
KQEKKKLHQKLITKRRRELLQKHREQRREQASVGEAFRTVEDAGQYLHQKRSLMEEHGAT
LEELQERLDQAALDDLRTLTLSLFEKATDELRRLQNSAMTQELLKRGVPWLFLQQILEEH
GKEMAARAEQLEGEERDRDQEGVQSVRQRLKDDAPEAVTEEQAELRRWEHLIFMKLCSSV
FSLSEEELLRMRQEVHGCFAQMDRSLALPKIRARVLLQQFQTAWREAEFVKLDQAVAAPE
LQQQSKVRKSRSKSKSKGELLKKCIEDKIHLCEEQASEDLVEKVRGELLRERVQRMEAQE
GGFAQSLVALQFQKASRVTETLSAYTALLSIQDLLLEELSASEMLTKSACTQILESHSRE
LQELERKLEDQLVQQEAAQQQQALASWQQWVADGPGILNEPGEVDSERQVSTVLHQALSK
SQTLLEQHQQCLREEQQNSVVLEDLLENMEADTFATLCSQELRLASYLARMAMVPGATLR
RLLSVVLPTASQPQLLALLDSATERHVDHAAESDGGAEQADVGRRRKHQSWWQALDGKLR
GDLISRGLEKMLWARKRKQSILKKTCLPLRERMIFSGKGSWPHLSLEPIGELAPVPIVGA
ETIDLLNTGEKLFIFRNPKEPEISLHVPPRKKKNFLNAKKAMRALGMD
NT seq 3927 nt   +upstreamnt  +downstreamnt
atggacccctcgggctcccgggggcgccccacgtgggtgctggccgggggtctcctggca
gtggccctggcgctggggggccgaggctgtctcggcgccagctcacgtccccgctggcgc
cccctcggcgcgcagccaccccgggatccccaggtggctcctaggtctgggcccggcctg
aggatccctccggggcggagcggggcggggcccgagagcagcacgcaggacttgccctgt
atgatttggcccaaagtggaatgctgtcactttaagactgcagtggaagcaccacttgga
atgaaattggacaagaaaatggaagtcttcatcccactctcaacttctgcagcctctagt
gggccatgggctcattccttatttgcttttataccctcctggcctaagaagaacttattt
aaaagagagtctcctataacacaccgcctgtatggggacatttcaagagaagttcaaggg
acttctgaaaatggagtaatttttcagaaatgtgcactggtgtctgggtcgagtgaagca
cagacagcccgcatatggctgcttgttaacaacaccaagacaacctcgtcagccaacctc
tcggagctgctcttgctggacagcattgctggtctcaccatttgggactctgtgggaaac
aggacctcggaaggattccaggcttttagcaagaagtttctgcaagtgggagatgccttt
gctgtcagctacgcagccacgctccaggctggagacctcgggaacggggagagcctcaag
cttcctgcccaactcacctttcagagctcgtcacggaacagaacacagctgaaagtgctt
ttttccataacagcagaagaaaacgtaacggttctgccgcaccacggcctccacgcagca
gggttcttcattgccttcctcctctcccttgtgctgacctgggctgccctcttcctcatg
gttcgctatcagtgtctgaagggaaacatgctcaccagacatcgggtttggcagtatgag
agcaagctggaacccttgccgttcacctcagctgatggcgtgaatgaggacctttccctt
aacgaccaaatgatagacattctgtcttccgaggaccctgggagcatgcttcaagcctta
gaagagttggagattgcaaccctgaatcgggcagatgcagatctggaggcttgtcgaaca
caaatcagcaaggatatcattgcccttctgctgaaaaatctcaccagcagtggccacctc
tcaccccaagtagagagaaaaatgagtgctgttttcaaaaagcagtttctattgctggaa
aatgaaatacaagaggagtacgatcggaagatggtggcattgacagctgaatgtgacctg
gaaacaagaaagaagatggaaaaccagtaccagagagagatgatggcaatggaggaagca
gaagagttgctgaaacgtgctggtgagaggtctgctgtagagtgcagcaaccttctgcgg
accctccatggcctggaacaggagcacttgaggaagtctctcgctttgcaacaagaagaa
gactttgccaaagctcacagacagctggctgttttccagagaaatgaactgcacagtatc
ttttttacccagataaaaagtgctattttcaaaggggaattgaaaccagaggcagctaaa
atgctgctgcaaaattattctaaaatacaggagaatgtagaagagttaatggactttttc
caggctagtaagaggtatcatctaagtaaaagatttggccacagggaatatctggtccag
aacctccagtcatcagagacccgtgtgcagggccttctgagcaccgctgcagcccagctg
actcacctcattcagaagcacgagagagcagggtacctggatgaagaccaaatggaaatg
ctattggagcgggctcagacagaagtcttttcaatcaagcagaagttggacaatgactta
aagcaggaaaagaaaaagctccaccaaaaattaataactaagagaagacgagagttgcta
caaaagcacagggagcagcgtagggagcaggcgtccgtcggcgaggccttccgaacggtt
gaggatgccggccagtacctgcaccagaagaggagcctgatggaggagcacggtgccacc
ctggaggagctgcaggagcgtctggaccaggccgccctggacgatctcaggaccctgacc
ctttcgctgtttgaaaaggccaccgacgagctgcggcgcctgcagaactcagccatgacc
caggagctgctcaagcgtggggtgccctggctcttcctgcagcagatcctggaggagcac
ggcaaggagatggctgcacgggccgagcagctggagggggaggagagggacagggaccag
gagggtgtccagagcgtgaggcagagactgaaggatgacgctcctgaggccgtgacagag
gagcaggcagagctgcgacgctgggagcacctgatcttcatgaagctctgctcctcagtc
ttctccctgtctgaagaggagctgctcaggatgaggcaggaggtccatggctgctttgct
cagatggacaggagcttggccctccccaagatccgggcccgagttctgctgcagcaattt
cagactgcgtggcgagaagcagagttcgtgaagctggaccaggccgtggctgcccctgag
ctgcagcaacagtccaaggtgagaaagtcacggtccaagagtaaaagcaagggagagctt
ctgaagaagtgcatcgaagacaaaattcacctctgtgaggaacaggcctctgaagacctg
gtggaaaaggttcgaggtgaattgctgcgggagagagtgcagcggatggaggcacaggag
ggaggctttgcacagtcgcttgttgctctgcagttccagaaggcgtcccgggtgaccgag
actctgtcggcctacaccgccctcctcagcatccaggacttgctcctggaagagctgagt
gcatctgagatgctgaccaagtcggcctgcacacagatcctggagtcgcacagccgggag
ctccaggagttggagaggaagctggaggaccagctggtgcagcaggaggcagcccagcag
cagcaggccctggcgagctggcagcagtgggtggccgatgggcccgggattctgaacgaa
cctggggaggtggattctgaaaggcaggtctctactgtcctgcaccaagccctgagcaag
agccagacattactggagcaacatcagcagtgtttgagagaggaacaacagaacagtgtc
gtgctagaagacttgttggaaaacatggaggcagacacctttgcaaccctgtgcagccag
gagctgagactggcatcgtacctggcgaggatggccatggtgcccggggccacgcttcgc
cggctcctgagtgtggtactgcccacagcctcacagcctcagctgctggccctgctggat
tcggccaccgagagacatgtggaccacgcagctgagagcgatggcggagcggagcaggcc
gacgtgggcaggcggaggaaacaccagagctggtggcaagccttagatggcaaactgcga
ggagatctgataagcagaggattagaaaagatgctgtgggcccgcaagagaaagcagagc
atattaaagaagacatgtctccctctcagagagaggatgatattctctggaaaaggaagt
tggccacacctgtcactggagcccattggcgaactggcccctgtacccattgtaggggca
gaaaccattgatctattaaacacaggagagaagctctttatattcagaaatccaaaggag
ccagagatctcactgcacgttcctcccaggaaaaagaagaactttttgaatgccaaaaag
gccatgagggccttgggcatggactag

DBGET integrated database retrieval system