KEGG   Homo sapiens (human): 84296
Entry
84296             CDS       T01001                                 
Symbol
GINS4, SLD5
Name
(RefSeq) GINS complex subunit 4
  KO
K10735  GINS complex subunit 4
Organism
hsa  Homo sapiens (human)
Network
nt06509  DNA replication
  Element
N01470  Pre-IC formation
N01471  Origin unwinding and elongation
N01473  DNA replication termination
N01474  TRAIP-dependent replisome disassembly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    84296 (GINS4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    84296 (GINS4)
SSDB
Motif
Pfam: SLD5_C Sld5
Other DBs
NCBI-GeneID: 84296
NCBI-ProteinID: NP_115712
OMIM: 610611
HGNC: 28226
Ensembl: ENSG00000147536
Pharos: Q9BRT9(Tdark)
UniProt: Q9BRT9
Structure
LinkDB
Position
8:41529261..41545030
AA seq 223 aa
MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEH
MEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPS
SLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQE
NILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaccgaagaagtggatttcctgggacaggactctgatgggggtagtgaggaagtggtc
ctaactcctgcagagctcattgaaagattggagcaggcctggatgaatgaaaagtttgcc
cctgagctgctggagagcaagcctgagattgtagaatgtgtcatggaacagctggagcac
atggaagaaaatctcaggagagccaaaagggaggacctgaaggtcagcatccaccaaatg
gagatggagaggatccgctacgtcctcagcagctacttgcggtgtcgcctcatgaagata
gagaagtttttccctcatgtccttgagaaggaaaaaacacgtcctgagggggagccttcc
agcctctcgccggaagagttggcctttgccagagagttcatggcgaacacagagtcctat
ctgaaaaatgtcgccttgaagcacatgccccctaacttacagaaggtggacctctttcgg
gcagttcccaaaccagatctagattcttacgtgtttctgagagtgagagaacgacaagaa
aacatactggtagaaccagacacagatgagcagagggactacgtgattgacctggagaag
ggctcacagcacttgatccgatacaaaaccattgcacctctggttgcatctggagctgtc
cagctaatttaa

DBGET integrated database retrieval system