KEGG   Homo sapiens (human): 8644
Entry
8644              CDS       T01001                                 
Symbol
AKR1C3, DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
Name
(RefSeq) aldo-keto reductase family 1 member C3
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00590  Arachidonic acid metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06226  KEAP1-NRF2 signaling
nt06251  CYP-mediated ROS formation
  Element
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    8644 (AKR1C3)
   00590 Arachidonic acid metabolism
    8644 (AKR1C3)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    8644 (AKR1C3)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    8644 (AKR1C3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    8644 (AKR1C3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     8644 (AKR1C3)
    1.1.1.188  prostaglandin-F synthase
     8644 (AKR1C3)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     8644 (AKR1C3)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     8644 (AKR1C3)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 8644
NCBI-ProteinID: NP_001240837
OMIM: 603966
HGNC: 386
Ensembl: ENSG00000196139
Vega: OTTHUMG00000017585
Pharos: P42330(Tchem)
UniProt: P42330 A0A0A0MSS8
Structure
LinkDB
Position
10:5048781..5107686
AA seq 323 aa
MDSKHQCLKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggattcaaaacatcagtgtttgaagctaaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcacctccagaggttccgagaagtaaagctttggaggtcacaaaatta
gcaatagaagctgggttccgccatatagattctgctcatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtccacttttcatcgaccagagttggtccgaccagccttggaa
aactcactgaagaaagctcaattggactatgttgacctctatcttattcattctccaatg
tctctaaagccaggtgaggaactttcaccaacagatgaaaatggaaaagtaatatttgac
atagtggatctctgtaccacctgggaggccatggagaagtgtaaggatgcaggattggcc
aagtccattggggtgtcaaacttcaaccgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccgtatttcaaccggagt
aaattgctagatttctgcaagtcgaaagatattgttctggttgcctatagtgctctggga
tctcaacgagacaaacgatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtttttgagttccagttgactgcagaggacatgaaagccatagatggcctagac
agaaatctccactattttaacagtgatagttttgctagccaccctaattatccatattca
gatgaatattaa

DBGET integrated database retrieval system