KEGG   Homo sapiens (human): 9817
Entry
9817              CDS       T01001                                 

Gene name
KEAP1, INrf2, KLHL19
Definition
(RefSeq) kelch like ECH associated protein 1
  KO
K10456  kelch-like protein 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05012  Parkinson disease
hsa05200  Pathways in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
nt06463  Parkinson disease
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
N01413  Metals to KEAP1-NRF2 signalig pathway
Disease
H00048  Hepatocellular carcinoma
Drug target
Dimethyl fumarate: D03846<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9817 (KEAP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9817 (KEAP1)
   05208 Chemical carcinogenesis - reactive oxygen species
    9817 (KEAP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    9817 (KEAP1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    9817 (KEAP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9817 (KEAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9817 (KEAP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9817 (KEAP1)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4
Other DBs
NCBI-GeneID: 9817
NCBI-ProteinID: NP_036421
OMIM: 606016
HGNC: 23177
Ensembl: ENSG00000079999
Vega: OTTHUMG00000180579
Pharos: Q14145(Tclin)
UniProt: Q14145 A0A024R7C0
LinkDB
Structure
PDB: 

Position
19p13.2
AA seq 624 aa
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcagccagatcccaggcctagcggggctggggcctgctgccgattcctgcccctgcag
tcacagtgccctgagggggcaggggacgcggtgatgtacgcctccactgagtgcaaggcg
gaggtgacgccctcccagcatggcaaccgcaccttcagctacaccctggaggatcatacc
aagcaggcctttggcatcatgaacgagctgcggctcagccagcagctgtgtgacgtcaca
ctgcaggtcaagtaccaggatgcaccggccgcccagttcatggcccacaaggtggtgctg
gcctcatccagccctgtcttcaaggccatgttcaccaacgggctgcgggagcagggcatg
gaggtggtgtccattgagggtatccaccccaaggtcatggagcgcctcattgaattcgcc
tacacggcctccatctccatgggcgagaagtgtgtcctccacgtcatgaacggtgctgtc
atgtaccagatcgacagcgttgtccgtgcctgcagtgacttcctggtgcagcagctggac
cccagcaatgccatcggcatcgccaacttcgctgagcagattggctgtgtggagttgcac
cagcgtgcccgggagtacatctacatgcattttggggaggtggccaagcaagaggagttc
ttcaacctgtcccactgccaactggtgaccctcatcagccgggacgacctgaacgtgcgc
tgcgagtccgaggtcttccacgcctgcatcaactgggtcaagtacgactgcgaacagcga
cggttctacgtccaggcgctgctgcgggccgtgcgctgccactcgttgacgccgaacttc
ctgcagatgcagctgcagaagtgcgagatcctgcagtccgactcccgctgcaaggactac
ctggtcaagatcttcgaggagctcaccctgcacaagcccacgcaggtgatgccctgccgg
gcgcccaaggtgggccgcctgatctacaccgcgggcggctacttccgacagtcgctcagc
tacctggaggcttacaaccccagtgacggcacctggctccggttggcggacctgcaggtg
ccgcggagcggcctggccggctgcgtggtgggcgggctgttgtacgccgtgggcggcagg
aacaactcgcccgacggcaacaccgactccagcgccctggactgttacaaccccatgacc
aatcagtggtcgccctgcgcccccatgagcgtgccccgtaaccgcatcggggtgggggtc
atcgatggccacatctatgccgtcggcggctcccacggctgcatccaccacaacagtgtg
gagaggtatgagccagagcgggatgagtggcacttggtggccccaatgctgacacgaagg
atcggggtgggcgtggctgtcctcaatcgtctcctttatgccgtggggggctttgacggg
acaaaccgccttaattcagctgagtgttactacccagagaggaacgagtggcgaatgatc
acagcaatgaacaccatccgaagcggggcaggcgtctgcgtcctgcacaactgtatctat
gctgctgggggctatgatggtcaggaccagctgaacagcgtggagcgctacgatgtggaa
acagagacgtggactttcgtagcccccatgaagcaccggcgaagtgccctggggatcact
gtccaccaggggagaatctacgtccttggaggctatgatggtcacacgttcctggacagt
gtggagtgttacgacccagatacagacacctggagcgaggtgacccgaatgacatcgggc
cggagtggggtgggcgtggctgtcaccatggagccctgccggaagcagattgaccagcag
aactgtacctgttga

DBGET integrated database retrieval system