KEGG   Homo sapiens (human): 9842
Entry
9842              CDS       T01001                                 
Symbol
PLEKHM1, AP162, B2, OPTA3, OPTB6
Name
(RefSeq) pleckstrin homology and RUN domain containing M1
  KO
K23282  pleckstrin homology domain-containing family M member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Disease
H00436  Osteopetrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    9842 (PLEKHM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9842 (PLEKHM1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9842 (PLEKHM1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    9842 (PLEKHM1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   9842 (PLEKHM1)
SSDB
Motif
Pfam: zf-RING_9 RUN PH DUF2072 Prok-RING_1 CPxCG_zf
Other DBs
NCBI-GeneID: 9842
NCBI-ProteinID: NP_055613
OMIM: 611466
HGNC: 29017
Ensembl: ENSG00000225190
Pharos: Q9Y4G2(Tbio)
UniProt: Q9Y4G2
Structure
LinkDB
Position
17:complement(45434209..45490721)
AA seq 1056 aa
MLSVVENGLDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIH
GLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRA
WLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLSTSGAELQRKESLDSISHSSGSEDIEVHHSGHK
IRRNQKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAE
DSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAPAEPLP
AQAASGTQDGVHVQEPRPQAPSPLDLQQPVESTSGQQPSSTVSETAREVGQGNGLQKAQA
HDGAGLKLVVSSPTSPKNKSWISEDDFYRPSREQPLESASDHPIASYRGTPGSRPGLHRH
FSQEPRKNCSLGALDQACVPSPGRRQAQAAPSQGHKSFRVVHRRQMGLSNPFRGLMKLGT
VERRGAMGIWKELFCELSPLEFRLYLSNEEHTCVENCSLLRCESVGPAHSDGRFELVFSG
KKLALRASSQDEAEDWLDRVREALQKVRPQQEDEWVNVQYPDQPEEPPEAPQGCLSPSDL
LSEPAALQGTQFDWSSAQVPEPDAIKESLLYLYMDRTWMPYIFSLSLEALKCFRIRNNEK
MLSDSHGVETIRDILPDTSLGGPSFFKIITAKAVLKLQAGNAEEAALWRDLVRKVLASYL
ETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPMEKGLDSQGCFCAGCSRQIGF
SFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLIN
LQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHRF
SVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVR
CAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA
NT seq 3171 nt   +upstreamnt  +downstreamnt
atgctttcagtggtggagaatggactggacccccaggctgccatcccggtcatcaagaag
aagctggtgggatccgtgaaggccttgcagaagcagtacgtgtccctggacacggtggtc
actagtgaagacggagatgccaacaccatgtgcagcgccctggaggccgtatttatccat
ggcctgcacgccaagcacatccgagctgaggccggaggaaaaaggaagaaaagtgcccac
cagaagcctctgccccagcctgtcttctggcccctcctgaaagctgtcacccacaaacac
atcatctcagagttggagcacctgacgtttgtcaacacggatgtgggccgctgccgggca
tggctgcggctggccctgaacgatggcctgatggagtgctacctgaagctgctgctgcag
gagcaggcccgcttgcatgagtactaccagcccaccgccctgctccgggatgctgaggag
ggcgagttcctccttagcttcctgcagggcctcacgtccttgtccttcgaactctcctac
aagtctgccatcttaaatgagtggacgctcaccccattggccctgtctgggctttgcccg
ctttctgagctggaccctctctctacctctggtgcagaactacagcggaaggaatctctg
gattccatttcccattcttcaggctctgaagacatcgaagtccatcactcgggccataag
atacggaggaaccagaagctgactgcctcctccctcagcctggacacggccagttcatcc
cagctgtcctgcagcctaaactctgatagctgcttactccaagagaatggctccaagagt
ccagaccattgcgaggagcccatgtcctgtgactcagacctgggcacagcaaatgctgag
gactcagaccggtctctgcaagaggtattgttggaattcagcaaagcccaggtaaactct
gtgccaaccaacggactgagccaagaaacagagatccccacaccacaggcctcgctctcc
ctccatggcctcaacaccagcacatacctgcactgtgaggcacctgcagagccccttcct
gcccaggcagcctctggaactcaagatggtgtccacgtgcaggagccgcgtccccaggcg
cccagccccctggacttacagcagcctgtagagagcacctcaggccagcagccttctagt
actgtcagcgagacagccagagaagtgggccaagggaatggcctgcagaaggcccaggct
catgacggagctggtctgaagctggtagtttcctcacccaccagtccgaaaaacaagagc
tggatctcagaggatgacttctaccggccttcccgggagcaacccctggagagtgcttca
gaccacccaatagcttcttacagggggactccagggtcaaggcctggtctccacaggcat
ttttctcaagaaccaagaaaaaactgctccctgggggcgttagaccaagcgtgtgtacct
tccccaggaagaaggcaagcccaggcagccccatcccaggggcataagagcttccgggtg
gtacaccggagacagatgggactgtccaacccattccggggtctcatgaagctgggcacc
gtggagcggcggggggcaatgggcatctggaaggagctcttctgcgagctctccccgctg
gagttccgcctctacctgagcaacgaggagcacacctgtgtggagaactgctcgctgctt
cgctgtgagtctgtggggccagcccatagtgatgggcgctttgagctggtcttctctggc
aagaagctggccctgcgcgcctcctcccaggacgaagctgaggactggctggaccgggtg
cgggaggccctgcagaaggtccggcctcagcaggaggatgagtgggtgaacgtgcagtac
ccagaccagcctgaggaaccccccgaggcgccccagggctgcctctctccctcagacctg
ctctcggagcccgcggccctccagggcacacagtttgactggtcgtccgcccaggttcca
gagccagatgccatcaaggagtccctgctgtacttgtacatggacaggacctggatgccc
tatatattttctctgtccttggaggctctgaaatgtttccgcatcaggaacaatgagaag
atgctgagtgacagccacggcgtggagaccatccgggacatcctgccagacaccagcctt
gggggcccatccttcttcaaaatcatcacggccaaggctgtcctgaagctgcaggccgga
aacgccgaggaagccgccctgtggagggatctggtccgcaaagtcctggcatcctacttg
gagacagccgaggaggcggtgaccctgggcgggagcctggatgaaaactgtcaggaggtg
ctgaaatttgccacccgggagaatggcttcctgctgcagtacctggtggctatccccatg
gagaaaggccttgactcccaaggctgcttctgcgcaggctgctcccggcagatcggcttc
tcctttgtacgacccaagctctgtgccttctctggcctctattactgtgacatctgccac
caagacgatgcctcagtgattccggccaggatcatccacaactgggacctcaccaagcgc
ccgatctgcaggcaggccctgaagtttctgacacagatccgggcccagcccctcatcaac
ctgcagatggtgaacgcgtctctgtacgagcatgtggagcggatgcacctcattgggagg
agacgggagcagctgaagctcctgggggattacctgggcctgtgccggagtggcgccctg
aaggagctcagcaagaggctcaaccacaggaattatctcttggaatctccgcataggttc
agtgttgctgacctccaacagatcgcagacggggtgtatgaaggattcctcaaggccctg
attgaatttgcctcccagcatgtctaccactgcgacctgtgcacccagcgcggcttcatc
tgccagatctgccagcaccacgacatcatcttcccctttgagtttgacaccacagtcagg
tgtgccgagtgcaagaccgtcttccaccagagctgccaggctgtggtgaagaagggctgc
ccccgctgtgcccgccggcgcaagtaccaggaacagaacattttcgcctga

DBGET integrated database retrieval system