KEGG   VARIANT: 4221v1
Entry
4221v1                      Variant                                
Name
MEN1 mutation
Gene
MEN1  menin 1 [KO:K14970]
Organism
hsa_var Human gene variants (Homo sapiens)
Variation
mutation L22R
ClinVar: 16677
dbSNP: rs104894256
Variation
mutation E363del
ClinVar: 16685
dbSNP: rs869025185
Variation
mutation W436R
ClinVar: 16686
dbSNP: rs104894259
Variation
mutation R527Ter
ClinVar: 16688
dbSNP: rs104894261
Network
nt06360  Cushing syndrome
  Element
N00290  Mutation-inactivated MEN1 to transcription
Reference
PMID:9103196
  Authors
Chandrasekharappa SC, Guru SC, Manickam P, Olufemi SE, Collins FS, Emmert-Buck MR, Debelenko LV, Zhuang Z, Lubensky IA, Liotta LA, Crabtree JS, Wang Y, Roe BA, Weisemann J, Boguski MS, Agarwal SK, Kester MB, Kim YS, Heppner C, Dong Q, Spiegel AM, Burns AL, Marx SJ
  Title
Positional cloning of the gene for multiple endocrine neoplasia-type 1.
  Journal
Science 276:404-7 (1997)
DOI:10.1126/science.276.5311.404
LinkDB

KEGG   Homo sapiens (human): 4297
Entry
4297              CDS       T01001                                 
Symbol
KMT2A, ALL-1, ALL1, CXXC7, HRX, HTRX, HTRX1, MLL, MLL1, MLL1A, TRX1, WDSTS
Name
(RefSeq) lysine methyltransferase 2A
  KO
K09186  [histone H3]-lysine4 N-trimethyltransferase MLL1 [EC:2.1.1.354]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa04934  Cushing syndrome
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
nt06360  Cushing syndrome
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
N00290  Mutation-inactivated MEN1 to transcription
Disease
H00001  B-cell acute lymphoblastic leukemia
H00002  T-cell acute lymphoblastic leukemia
H01879  Wiedemann-Steiner syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    4297 (KMT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4297 (KMT2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    4297 (KMT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4297 (KMT2A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4297 (KMT2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     4297 (KMT2A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    4297 (KMT2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     4297 (KMT2A)
   HMT complexes
    MLL-HCF complex
     4297 (KMT2A)
SSDB
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H Bromodomain PHD_2 PHD_4
Other DBs
NCBI-GeneID: 4297
NCBI-ProteinID: NP_005924
OMIM: 159555
HGNC: 7132
Ensembl: ENSG00000118058
Vega: OTTHUMG00000166337
Pharos: Q03164(Tbio)
UniProt: Q03164
Structure
LinkDB
Position
11:118436492..118526832
AA seq 3969 aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKD
ISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSS
SPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPED
VGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSL
SISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKI
LIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTD
KRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKA
PQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVP
KTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNIL
STLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNK
CRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCA
KLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYT
CVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESI
PSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINS
DGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDH
NYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPE
LNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKN
VHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDL
IKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDC
EDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPT
SFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCR
PLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYS
RNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHL
DGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTS
RELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVK
TLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNL
KPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTV
KVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSC
QDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSY
GEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASH
NLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPED
AGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNL
LDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEG
LGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPT
VPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMD
ADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQIS
NAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTS
VLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNP
PSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTP
SNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAP
LLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPG
HVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAI
TAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQV
SNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKT
KRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSS
QKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESI
TEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRML
GILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNF
LASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHG
RGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGN
AARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCG
AKKCRKFLN
NT seq 11910 nt   +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcgccggggcctagggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgtg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagaggatgagcaattcttaggttttggctcagatgaagaagtcagagtgcga
agtcccacaaggtctccttcagttaaaactagtcctcgaaaacctcgtgggagacctaga
agtggctctgaccgaaattcagctatcctctcagatccatctgtgttttcccctctaaat
aaatcagagaccaaatctggagataagatcaagaagaaagattctaaaagtatagaaaag
aagagaggaagacctcccaccttccctggagtaaaaatcaaaataacacatggaaaggac
atttcagagttaccaaagggaaacaaagaagatagcctgaaaaaaattaaaaggacacct
tctgctacgtttcagcaagccacaaagattaaaaaattaagagcaggtaaactctctcct
ctcaagtctaagtttaagacagggaagcttcaaataggaaggaagggggtacaaattgta
cgacggagaggaaggcctccatcaacagaaaggataaagaccccttcgggtctcctcatt
aattctgaactggaaaagccccagaaagtccggaaagacaaggaaggaacacctccactt
acaaaagaagataagacagttgtcagacaaagccctcgaaggattaagccagttaggatt
attccttcttcaaaaaggacagatgcaaccattgctaagcaactcttacagagggcaaaa
aagggggctcaaaagaaaattgaaaaagaagcagctcagctgcagggaagaaaggtgaag
acacaggtcaaaaatattcgacagttcatcatgcctgttgtcagtgctatctcctcgcgg
atcattaagacccctcggcggtttatagaggatgaggattatgaccctccaattaaaatt
gcccgattagagtctacaccgaatagtagattcagtgccccgtcctgtggatcttctgaa
aaatcaagtgcagcttctcagcactcctctcaaatgtcttcagactcctctcgatctagt
agccccagtgttgatacctccacagactctcaggcttctgaggagattcaggtacttcct
gaggagcggagcgatacccctgaagttcatcctccactgcccatttcccagtccccagaa
aatgagagtaatgataggagaagcagaaggtattcagtgtcggagagaagttttggatct
agaacgacgaaaaaattatcaactctacaaagtgccccccagcagcagacctcctcgtct
ccacctccacctctgctgactccaccgccaccactgcagccagcctccagtatctctgac
cacacaccttggcttatgcctccaacaatccccttagcatcaccatttttgcctgcttcc
actgctcctatgcaagggaagcgaaaatctattttgcgagaaccgacatttaggtggact
tctttaaagcattctaggtcagagccacaatacttttcctcagcaaagtatgccaaagaa
ggtcttattcgcaaaccaatatttgataatttccgaccccctccactaactcccgaggac
gttggctttgcatctggtttttctgcatctggtaccgctgcttcagcccgattgttttcg
ccactccattctggaacaaggtttgatatgcacaaaaggagccctcttctgagagctcca
agatttactccaagtgaggctcactctagaatatttgagtctgtaaccttgcctagtaat
cgaacttctgctggaacatcttcttcaggagtatccaatagaaaaaggaaaagaaaagtg
tttagtcctattcgatctgaaccaagatctccttctcactccatgaggacaagaagtgga
aggcttagtagttctgagctctcacctctcacccccccgtcttctgtctcttcctcgtta
agcatttctgttagtcctcttgccactagtgccttaaacccaacttttacttttccttct
cattccctgactcagtctggggaatctgcagagaaaaatcagagaccaaggaagcagact
agtgctccggcagagccattttcatcaagtagtcctactcctctcttcccttggtttacc
ccaggctctcagactgaaagagggagaaataaagacaaggcccccgaggagctgtccaaa
gatcgagatgctgacaagagcgtggagaaggacaagagtagagagagagaccgggagaga
gaaaaggagaataagcgggagtcaaggaaagagaaaaggaaaaagggatcagaaattcag
agtagttctgctttgtatcctgtgggtagggtttccaaagagaaggttgttggtgaagat
gttgccacttcatcttctgccaaaaaagcaacagggcggaagaagtcttcatcacatgat
tctgggactgatattacttctgtgactcttggggatacaacagctgtcaaaaccaaaata
cttataaagaaagggagaggaaatctggaaaaaaccaacttggacctcggcccaactgcc
ccatccctggagaaggagaaaaccctctgcctttccactccttcatctagcactgttaaa
cattccacttcctccataggctccatgttggctcaggcagacaagcttccaatgactgac
aagagggttgccagcctcctaaaaaaggccaaagctcagctctgcaagattgagaagagt
aagagtcttaaacaaaccgaccagcccaaagcacagggtcaagaaagtgactcatcagag
acctctgtgcgaggaccccggattaaacatgtctgcagaagagcagctgttgcccttggc
cgaaaacgagctgtgtttcctgatgacatgcccaccctgagtgccttaccatgggaagaa
cgagaaaagattttgtcttccatggggaatgatgacaagtcatcaattgctggctcagaa
gatgctgaacctcttgctccacccatcaaaccaattaaacctgtcactagaaacaaggca
ccccaggaacctccagtaaagaaaggacgtcgatcgaggcggtgtgggcagtgtcccggc
tgccaggtgcctgaggactgtggtgtttgtactaattgcttagataagcccaagtttggt
ggtcgcaatataaagaagcagtgctgcaagatgagaaaatgtcagaatctacaatggatg
ccttccaaagcctacctgcagaagcaagctaaagctgtgaaaaagaaagagaaaaagtct
aagaccagtgaaaagaaagacagcaaagagagcagtgttgtgaagaacgtggtggactct
agtcagaaacctaccccatcagcaagagaggatcctgccccaaagaaaagcagtagtgag
cctcctccacgaaagcccgtcgaggaaaagagtgaagaagggaatgtctcggcccctggg
cctgaatccaaacaggccaccactccagcttccaggaagtcaagcaagcaggtctcccag
ccagcactggtcatcccgcctcagccacctactacaggaccgccaagaaaagaagttccc
aaaaccactcctagtgagcccaagaaaaagcagcctccaccaccagaatcaggtccagag
cagagcaaacagaaaaaagtggctccccgcccaagtatccctgtaaaacaaaaaccaaaa
gaaaaggaaaaaccacctccggtcaataagcaggagaatgcaggcactttgaacatcctc
agcactctctccaatggcaatagttctaagcaaaaaattccagcagatggagtccacagg
atcagagtggactttaaggaggattgtgaagcagaaaatgtgtgggagatgggaggctta
ggaatcttgacttctgttcctataacacccagggtggtttgctttctctgtgccagtagt
gggcatgtagagtttgtgtattgccaagtctgttgtgagcccttccacaagttttgttta
gaggagaacgagcgccctctggaggaccagctggaaaattggtgttgtcgtcgttgcaaa
ttctgtcacgtttgtggaaggcaacatcaggctacaaagcagctgctggagtgtaataag
tgccgaaacagctatcaccctgagtgcctgggaccaaactaccccaccaaacccacaaag
aagaagaaagtctggatctgtaccaagtgtgttcgctgtaagagctgtggatccacaact
ccaggcaaagggtgggatgcacagtggtctcatgatttctcactgtgtcatgattgcgcc
aagctctttgctaaaggaaacttctgccctctctgtgacaaatgttatgatgatgatgac
tatgagagtaagatgatgcaatgtggaaagtgtgatcgctgggtccattccaaatgtgag
aatctttcagatgagatgtatgagattctatctaatctgccagaaagtgtggcctacact
tgtgtgaactgtactgagcggcaccctgcagagtggcgactggcccttgaaaaagagctg
cagatttctctgaagcaagttctgacagctttgttgaattctcggactaccagccatttg
ctacgctaccggcaggctgccaagcctccagacttaaatcccgagacagaggagagtata
ccttcccgcagctcccccgaaggacctgatccaccagttcttactgaggtcagcaaacag
gatgatcagcagcctttagatctagaaggagtcaagaggaagatggaccaagggaattac
acatctgtgttggagttcagtgatgatattgtgaagatcattcaagcagccattaattca
gatggaggacagccagaaattaaaaaagccaacagcatggtcaagtccttcttcattcgg
caaatggaacgtgtttttccatggttcagtgtcaaaaagtccaggttttgggagccaaat
aaagtatcaagcaacagtgggatgttaccaaacgcagtgcttccaccttcacttgaccat
aattatgctcagtggcaggagcgagaggaaaacagccacactgagcagcctcctttaatg
aagaaaatcattccagctcccaaacccaaaggtcctggagaaccagactcaccaactcct
ctgcatcctcctacaccaccaattttgagtactgataggagtcgagaagacagtccagag
ctgaacccacccccaggcatagaagacaatagacagtgtgcgttatgtttgacttatggt
gatgacagtgctaatgatgctggtcgtttactatatattggccaaaatgagtggacacat
gtaaattgtgctttgtggtcagcggaagtgtttgaagatgatgacggatcactaaagaat
gtgcatatggctgtgatcaggggcaagcagctgagatgtgaattctgccaaaagccagga
gccaccgtgggttgctgtctcacatcctgcaccagcaactatcacttcatgtgttcccga
gccaagaactgtgtctttctggatgataaaaaagtatattgccaacgacatcgggatttg
atcaaaggcgaagtggttcctgagaatggatttgaagttttcagaagagtgtttgtggac
tttgaaggaatcagcttgagaaggaagtttctcaatggcttggaaccagaaaatatccac
atgatgattgggtctatgacaatcgactgcttaggaattctaaatgatctctccgactgt
gaagataagctctttcctattggatatcagtgttccagggtatactggagcaccacagat
gctcgcaagcgctgtgtatatacatgcaagatagtggagtgccgtcctccagtcgtagag
ccggatatcaacagcactgttgaacatgatgaaaacaggaccattgcccatagtccaaca
tcttttacagaaagttcatcaaaagagagtcaaaacacagctgaaattataagtcctcca
tcaccagaccgacctcctcattcacaaacctctggctcctgttattatcatgtcatctca
aaggtccccaggattcgaacacccagttattctccaacacagagatcccctggctgtcga
ccgttgccttctgcaggaagtcctaccccaaccactcatgaaatagtcacagtaggtgat
cctttactctcctctggacttcgaagcattggctccaggcgtcacagtacctcttcctta
tcaccccagcggtccaaactccggataatgtctccaatgagaactgggaatacttactct
aggaataatgtttcctcagtctccaccaccgggaccgctactgatcttgaatcaagtgcc
aaagtagttgatcatgtcttagggccactgaattcaagtactagtttagggcaaaacact
tccacctcttcaaatttgcaaaggacagtggttactgtaggcaataaaaacagtcacttg
gatggatcttcatcttcagaaatgaagcagtccagtgcttcagacttggtgtccaagagc
tcctctttaaagggagagaagaccaaagtgctgagttccaagagctcagagggatctgca
cataatgtggcttaccctggaattcctaaactggccccacaggttcataacacaacatct
agagaactgaatgttagtaaaatcggctcctttgctgaaccctcttcagtgtcgttttct
tctaaagaggccctctccttcccacacctccatttgagagggcaaaggaatgatcgagac
caacacacagattctacccaatcagcaaactcctctccagatgaagatactgaagtcaaa
accttgaagctatctggaatgagcaacagatcatccattatcaacgaacatatgggatct
agttccagagataggagacagaaagggaaaaaatcctgtaaagaaactttcaaagaaaag
cattccagtaaatcttttttggaacctggtcaggtgacaactggtgaggaaggaaacttg
aagccagagtttatggatgaggttttgactcctgagtatatgggccaacgaccatgtaac
aatgtttcttctgataagattggtgataaaggcctttctatgccaggagtccccaaagct
ccacccatgcaagtagaaggatctgccaaggaattacaggcaccacggaaacgcacagtc
aaagtgacactgacacctctaaaaatggaaaatgagagtcaatccaaaaatgccctgaaa
gaaagtagtcctgcttcccctttgcaaatagagtcaacatctcccacagaaccaatttca
gcctctgaaaatccaggagatggtccagtggcccaaccaagccccaataatacctcatgc
caggattctcaaagtaacaactatcagaatcttccagtacaggacagaaacctaatgctt
ccagatggccccaaacctcaggaggatggctcttttaaaaggaggtatccccgtcgcagt
gcccgtgcacgttctaacatgttttttgggcttaccccactctatggagtaagatcctat
ggtgaagaagacattccattctacagcagctcaactgggaagaagcgaggcaagagatca
gctgaaggacaggtggatggggccgatgacttaagcacttcagatgaagacgacttatac
tattacaacttcactagaacagtgatttcttcaggtggagaggaacgactggcatcccat
aatttatttcgggaggaggaacagtgtgatcttccaaaaatctcacagttggatggtgtt
gatgatgggacagagagtgatactagtgtcacagccacaacaaggaaaagcagccagatt
ccaaaaagaaatggtaaagaaaatggaacagagaacttaaagattgatagacctgaagat
gctggggagaaagaacatgtcactaagagttctgttggccacaaaaatgagccaaagatg
gataactgccattctgtaagcagagttaaaacacagggacaagattccttggaagctcag
ctcagctcattggagtcaagccgcagagtccacacaagtaccccctccgacaaaaattta
ctggacacctataatactgagctcctgaaatcagattcagacaataacaacagtgatgac
tgtgggaatatcctgccttcagacattatggactttgtactaaagaatactccatccatg
caggctttgggtgagagcccagagtcatcttcatcagaactcctgaatcttggtgaagga
ttgggtcttgacagtaatcgtgaaaaagacatgggtctttttgaagtattttctcagcag
ctgcctacaacagaacctgtggatagtagtgtctcttcctctatctcagcagaggaacag
tttgagttgcctctagagctaccatctgatctgtctgtcttgaccacccggagtcccact
gtccccagccagaatcccagtagactagctgttatctcagactcaggggagaagagagta
accatcacagaaaaatctgtagcctcctctgaaagtgacccagcactgctgagcccagga
gtagatccaactcctgaaggccacatgactcctgatcattttatccaaggacacatggat
gcagaccacatctctagccctccttgtggttcagtagagcaaggtcatggcaacaatcag
gatttaactaggaacagtagcacccctggccttcaggtacctgtttccccaactgttccc
atccagaaccagaagtatgtgcccaattctactgatagtcctggcccgtctcagatttcc
aatgcagctgtccagaccactccaccccacctgaagccagccactgagaaactcatagtt
gttaaccagaacatgcagccactttatgttctccaaactcttccaaatggagtgacccaa
aaaatccaattgacctcttctgttagttctacacccagtgtgatggagacaaatacttca
gtattgggacccatgggaggtggtctcacccttaccacaggactaaatccaagcttgcca
acttctcaatctttgttcccttctgctagcaaaggattgctacccatgtctcatcaccag
cacttacattccttccctgcagctactcaaagtagtttcccaccaaacatcagcaatcct
ccttcaggcctgcttattggggttcagcctcctccggatccccaacttttggtttcagaa
tccagccagaggacagacctcagtaccacagtagccactccatcctctggactcaagaaa
agacccatatctcgtctacagacccgaaagaataaaaaacttgctccctctagtacccct
tcaaacattgccccttctgatgtggtttctaatatgacattgattaacttcacaccctcc
cagcttcctaatcatccaagtctgttagatttggggtcacttaatacttcatctcaccga
actgtccccaacatcataaaaagatctaaatctagcatcatgtattttgaaccggcaccc
ctgttaccacagagtgtgggaggaactgctgccacagcggcaggcacatcaacaataagc
caggatactagccacctcacatcagggtctgtgtctggcttggcatccagttcctctgtc
ttgaatgttgtatccatgcaaactaccacaacccctacaagtagtgcgtcagttccagga
cacgtcaccttaaccaacccaaggttgcttggtaccccagatattggctcaataagcaat
cttttaatcaaagctagccagcagagcctggggattcaggaccagcctgtggctttaccg
ccaagttcaggaatgtttccacaactggggacatcacagaccccctctactgctgcaata
acagcggcatctagcatctgtgtgctcccctccactcagactacgggcataacagccgct
tcaccttctggggaagcagacgaacactatcagcttcagcatgtgaaccagctccttgcc
agcaaaactgggattcattcttcccagcgtgatcttgattctgcttcagggccccaggta
tccaactttacccagacggtagacgctcctaatagcatgggactggagcagaacaaggct
ttatcctcagctgtgcaagccagccccacctctcctgggggttctccatcctctccatct
tctggacagcggtcagcaagcccttcagtgccgggtcccactaaacccaaaccaaaaacc
aaacggtttcagctgcctctagacaaagggaatggcaagaagcacaaagtttcccatttg
cggaccagttcttctgaagcacacattccagaccaagaaacgacatccctgacctcaggc
acagggactccaggagcagaggctgagcagcaggatacagctagcgtggagcagtcctcc
cagaaggagtgtgggcaacctgcagggcaagtcgctgttcttccggaagttcaggtgacc
caaaatccagcaaatgaacaagaaagtgcagaacctaaaacagtggaagaagaggaaagt
aatttcagctccccactgatgctttggcttcagcaagaacaaaagcggaaggaaagcatt
actgagaaaaaacccaagaaaggacttgtttttgaaatttccagtgatgatggctttcag
atctgtgcagaaagtattgaagatgcctggaagtcattgacagataaagtccaggaagct
cgatcaaatgcccgcctaaagcagctctcatttgcaggtgttaacggtttgaggatgctg
gggattctccatgatgcagttgtgttcctcattgagcagctgtctggtgccaagcactgt
cgaaattacaaattccgtttccacaagccagaggaggccaatgaaccccccttgaaccct
cacggctcagccagggctgaagtccacctcaggaagtcagcatttgacatgtttaacttc
ctggcttctaaacatcgtcagcctcctgaatacaaccccaatgatgaagaagaggaggag
gtacagctgaagtcagctcggagggcaactagcatggatctgccaatgcccatgcgcttc
cggcacttaaaaaagacttctaaggaggcagttggtgtctacaggtctcccatccatggc
cggggtcttttctgtaagagaaacattgatgcaggtgagatggtgattgagtatgccggc
aacgtcatccgctccatccagactgacaagcgggaaaagtattacgacagcaagggcatt
ggttgctatatgttccgaattgatgactcagaggtagtggatgccaccatgcatggaaat
gctgcacgcttcatcaatcactcgtgtgagcctaactgctattctcgggtcatcaatatt
gatgggcagaagcacattgtcatctttgccatgcgtaagatctaccgaggagaggaactc
acttacgactataagttccccattgaggatgccagcaacaagctgccctgcaactgtggc
gccaagaaatgccggaagttcctaaactaa

DBGET integrated database retrieval system