KEGG   Homo sapiens (human): 2056Help
Entry
2056              CDS       T01001                                 

Gene name
EPO, DBAL, ECYT5, EP, MVCD2
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01360  Allergic rhinitis
H01457  Diabetic retinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    2056 (EPO)
   04066 HIF-1 signaling pathway
    2056 (EPO)
   04151 PI3K-Akt signaling pathway
    2056 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2056 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2056 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2056 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2056 (EPO)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2056 (EPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 2056
NCBI-ProteinID: NP_000790
OMIM: 133170
HGNC: 3415
Ensembl: ENSG00000130427
Vega: OTTHUMG00000152121
Pharos: P01588(Tbio)
CPD: C18200
UniProt: P01588 G9JKG7
LinkDB All DBs
Structure
PDB: 

Position
7q22.1
AA seq 193 aa AA seqDB search
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgctgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcgggcagcaggccgtagaagtctggcagggcctggccctgctgtcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

DBGET integrated database retrieval system