KEGG   Homo sapiens (human): 4088Help
Entry
4088              CDS       T01001                                 

Gene name
SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3
Definition
(RefSeq) SMAD family member 3
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04144  Endocytosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04659  Th17 cell differentiation
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
Module
hsa_M00680  TGF-beta signaling
hsa_M00681  Activin signaling
Network
N00063  TGF-beta signaling pathway
N00064  Mutation-inactivated TGFBR2 to TGF-beta signaling pathway
N00065  Mutation-inactivated SMAD2 to TGF-beta signaling pathway
N00106  AML1-EVI1 fusion to TGF-beta signaling pathway
N00107  EVI-1 overexpression to TGF-beta signaling pathway
N00241  TGFBR2-reduced expression to TGF-beta signaling pathway
N00256  TGFBR1-reduced expression to TGF-beta signaling pathway
Disease
H00800  Loeys-Dietz syndrome (LDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4088 (SMAD3)
   04350 TGF-beta signaling pathway
    4088 (SMAD3)
   04390 Hippo signaling pathway
    4088 (SMAD3)
   04371 Apelin signaling pathway
    4088 (SMAD3)
   04068 FoxO signaling pathway
    4088 (SMAD3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4088 (SMAD3)
  Cell growth and death
   04110 Cell cycle
    4088 (SMAD3)
   04218 Cellular senescence
    4088 (SMAD3)
  Cellular community - eukaryotes
   04520 Adherens junction
    4088 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    4088 (SMAD3)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    4088 (SMAD3)
  Endocrine system
   04926 Relaxin signaling pathway
    4088 (SMAD3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4088 (SMAD3)
   05210 Colorectal cancer
    4088 (SMAD3)
   05212 Pancreatic cancer
    4088 (SMAD3)
   05225 Hepatocellular carcinoma
    4088 (SMAD3)
   05226 Gastric cancer
    4088 (SMAD3)
   05220 Chronic myeloid leukemia
    4088 (SMAD3)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    4088 (SMAD3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4088 (SMAD3)
  Infectious diseases
   05166 HTLV-I infection
    4088 (SMAD3)
   05161 Hepatitis B
    4088 (SMAD3)
   05142 Chagas disease (American trypanosomiasis)
    4088 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 4088
NCBI-ProteinID: NP_005893
OMIM: 603109
HGNC: 6769
Ensembl: ENSG00000166949
Vega: OTTHUMG00000133230
Pharos: P84022(Tbio)
UniProt: P84022 A0A024R5Z3 Q9P0T0
LinkDB All DBs
Structure
PDB: 

Position
15q22.33
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccagacctgcacagccac
cacgagctacgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcgcagccatccatgactgtggatggcttc
accgacccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacacggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccagtcggtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagactgtgaccagtaccccctgctggattgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system