KEGG   Homo sapiens (human): 57053
Entry
57053             CDS       T01001                                 

Gene name
CHRNA10
Definition
(RefSeq) cholinergic receptor nicotinic alpha 10 subunit
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Trimetaphan (DG00251): D00612
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57053 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    57053 (CHRNA10)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   57053 (CHRNA10)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 57053
NCBI-ProteinID: NP_065135
OMIM: 606372
HGNC: 13800
Ensembl: ENSG00000129749
Vega: OTTHUMG00000011844
Pharos: Q9GZZ6(Tbio)
UniProt: Q9GZZ6
LinkDB
Position
11p15.4
AA seq 450 aa
MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQS
RPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
RLARVMDRFFLAIFFSMALVMSLLVLVQAL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggggctccggagccaccacctcagcctgggccttctgcttctgtttctactccctgca
gagtgcctgggagctgagggccggctggctctcaagctgttccgtgacctctttgccaac
tacacaagtgccctgagacctgtggcagacacagaccagactctgaatgtgaccctggag
gtgacactgtcccagatcatcgacatggatgaacggaaccaggtgctgaccctgtatctg
tggatacggcaggagtggacagatgcctacctacgatgggaccccaatgcctatggtggc
ctggatgccatccgcatccccagcagtcttgtgtggcggccagacatcgtactctataac
aaagccgacgcgcagcctccaggttccgccagcaccaacgtggtcctgcgccacgatggc
gccgtgcgctgggacgcgccggccatcacgcgcagctcgtgccgcgtggatgtagcagcc
ttcccgttcgacgcccagcactgcggcctgacgttcggctcctggactcacggcgggcac
caactggatgtgcggccgcgcggcgctgcagccagcctggcggacttcgtggagaacgtg
gagtggcgcgtgctgggcatgccggcgcggcggcgcgtgctcacctacggctgctgctcc
gagccctaccccgacgtcaccttcacgctgctgctgcgccgccgcgccgccgcctacgtg
tgcaacctgctgctgccctgcgtgctcatctcgctgcttgcgccgctcgccttccacctg
cctgccgactcaggcgagaaggtgtcgctgggcgtcaccgtgctgctggcgctcaccgtc
ttccagttgctgctggccgagagcatgccaccggccgagagcgtgccgctcatcgggaag
tactacatggccactatgaccatggtcacattctcaacagcactcaccatccttatcatg
aacctgcattactgtggtcccagtgtccgcccagtgccagcctgggctagggccctcctg
ctgggacacctggcacggggcctgtgcgtgcgggaaagaggggagccctgtgggcagtcc
aggccacctgagttatctcctagcccccagtcgcctgaaggaggggctggccccccagcg
ggcccttgccacgagccacgatgtctgtgccgccaggaagccctactgcaccacgtagcc
accattgccaataccttccgcagccaccgagctgcccagcgctgccatgaggactggaag
cgcctggcccgtgtgatggaccgcttcttcctggccatcttcttctccatggccctggtc
atgagcctcctggtgctggtgcaggccctgtga

DBGET integrated database retrieval system