KEGG   Homo sapiens (human): 2767
Entry
2767              CDS       T01001                                 

Gene name
GNA11, FBH, FBH2, FHH2, GNA-11, HHC2, HYPOC2
Definition
(RefSeq) G protein subunit alpha 11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04540  Gap junction
hsa04725  Cholinergic synapse
hsa04730  Long-term depression
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04929  GnRH secretion
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa05142  Chagas disease
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06322  TRH-TSH-TH signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06361  Hypogonadotropic hypogonadism
  Element
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
N00869  KISS1-KISS1R-PLCB-PKC signaling pathway
N00870  Mutation-inactivated KISS1 to KISS1-KISS1R-PLCB-PKC signaling pathway
N00871  Mutation-inactivated KISS1R to KISS1-KISS1R-PLCB-PKC signaling pathway
N00872  Mutation-activated KISS1R to KISS1-KISS1R-PLCB-PKC signaling pathway
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
N00918  TRH-TRHR-PLCB-PKC signaling pathway
N00919  Mutation-inactivated TRHR to PLCB-PKC signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Disease
H02026  Familial hypocalciuric hypercalcemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2767 (GNA11)
   04022 cGMP-PKG signaling pathway
    2767 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2767 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2767 (GNA11)
   04929 GnRH secretion
    2767 (GNA11)
   04912 GnRH signaling pathway
    2767 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    2767 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    2767 (GNA11)
   04925 Aldosterone synthesis and secretion
    2767 (GNA11)
   04927 Cortisol synthesis and secretion
    2767 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    2767 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    2767 (GNA11)
   04730 Long-term depression
    2767 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2767 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2767 (GNA11)
   05163 Human cytomegalovirus infection
    2767 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2767 (GNA11)
   05142 Chagas disease
    2767 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2767 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2767 (GNA11)
   04031 GTP-binding proteins [BR:hsa04031]
    2767 (GNA11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2767 (GNA11)
  Exosomal proteins of melanoma cells
   2767 (GNA11)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2767 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 2767
NCBI-ProteinID: NP_002058
OMIM: 139313
HGNC: 4379
Ensembl: ENSG00000088256
Vega: OTTHUMG00000180631
Pharos: P29992(Tbio)
UniProt: P29992
LinkDB
Structure
PDB: 
6OIJ

Position
19p13.3
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggcgccggctactcggaggaggacaagcgcggcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagtgccatcaagaccctgtgggaggacccgggc
atccaggaatgctacgaccgcaggcgcgagtaccagctctccgactctgccaagtactac
ctgaccgacgttgaccgcatcgccaccttgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttccggatggtggatgtggggggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgaatacgaccaagtcctggtg
gagtcggacaacgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctgtactcgcacctggtggactacttccccgagttcgatggtccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacggagaacatccgcttcgtg
ttcgcggccgtgaaggacaccatcctgcagctcaacctcaaggagtacaacctggtctga

DBGET integrated database retrieval system